KEGG   Mycobacterium chimaera: AN480_10415Help
Entry
AN480_10415       CDS       T04926                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00071  Fatty acid degradation
mchi00592  alpha-Linolenic acid metabolism
mchi01040  Biosynthesis of unsaturated fatty acids
mchi01100  Metabolic pathways
mchi01110  Biosynthesis of secondary metabolites
mchi01212  Fatty acid metabolism
Module
mchi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AN480_10415
   00592 alpha-Linolenic acid metabolism
    AN480_10415
   01040 Biosynthesis of unsaturated fatty acids
    AN480_10415
Enzymes [BR:mchi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AN480_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AOS91765
UniProt: A0A220YAP5
Position
complement(2275846..2277798)
Genome map
AA seq 650 aa AA seqDB search
MAPQKTSTAEHLRNALDGRWRDVRNRMRTTLTEDLFRPHYTPNTVIARTKVAEQMRIMAA
FGAAADSFRKEHGGTGDVGAAITMIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTERHHE
TYVPKIISLELRGCFAMTETGHGSDVQSLETTATYDAETQEFVIDSPTPSARKDYIGGAA
ETATMAAVFAQLITTEDGKPVNHGVHCVLVPIRDEDGNDLPGITTSDCEYKGGLPGVDNG
RIVFDHVRVPRVNLLNKYGDVAPDGTYSSPIENPNRRFFTMLGTLVRGRITVGGSAGAAG
RVALDIATRYALQRRQFSAPDDGSEVLIMDYLVHQRRLFPLIAKSYALQFAQNELVSKCH
DVQSADAPDADEQRELEARAAGLKAANTWHASRAIQESREACGGAGYMAENRLIGLRGDT
DVFTTFEGDNHVLTQLVAKELLTAYADDIKSMSPVEWVRFAANTVGERVIKRTAAEAIIQ
TIVDSRQDSEEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQDHV
LHAASAHIDRVVLEAFVAGIDGCANEEARELLGILCDLYALSVIEDDKAWYIEHRYLSTE
RAKAVTRGINDRCRALRPHAATLVDGFGVPEQLRYAEMLHPENLADAVTS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgccacaaaagacaagcaccgcagaacatctccgcaacgcgctggacggccggtgg
cgtgacgtcagaaaccggatgcggacgacgctgaccgaggacctgttccgcccgcactac
acccccaacacggtgatcgcccgcaccaaggtggcggagcagatgaggatcatggcggcg
ttcggcgcggccgccgacagcttccgcaaagaacatggcggcaccggcgacgtcggcgcg
gcgatcacgatgatcgagatgctggcgatgtcggacctctcgctgatggtgaaggccggg
gtgcagtgggggctgttcggcggtgccgtggagaacctgggcaccgagcgccaccacgag
acctacgtgcccaagatcatcagcctggaattgcgcggctgtttcgcgatgaccgagacc
gggcacggcagcgacgtgcagtcgctggagaccaccgcgacctacgacgccgagacgcag
gagttcgtcatcgactcccccaccccgtcggcgcgcaaggactacatcgggggcgcggcc
gaaaccgcaaccatggcagcggttttcgcgcaactgatcaccaccgaggacggcaagccg
gtcaatcacggcgtgcactgcgtgctggtcccgatccgcgacgaggacggcaacgacctg
cccgggatcaccacgtcggactgcgaatacaagggcgggctgcccggggtggacaacggc
cgcatcgtgttcgaccacgttcgcgtcccgcgggtgaacctgttgaacaagtacggcgat
gtcgcccccgacggcacctacagctcgccgatcgagaaccccaaccgccggttcttcacc
atgctgggcactttggtgcgcggccggatcaccgtgggcggcagcgccggcgccgccggc
cgggtggcgctggacatcgcgacccggtatgcgttgcagcgcaggcagttcagcgccccc
gacgacggttccgaggtgctgatcatggactacctggtgcaccagcggcggctgttcccg
ctgatcgcgaagtcctacgccctgcagttcgcgcagaacgaactggtcagcaaatgtcat
gacgtccagagcgccgacgcacccgacgccgacgagcaacgcgagctcgaagcccgcgcg
gccgggctaaaggccgccaacacctggcatgccagccgcgcgatccaggaatcccgcgag
gcgtgcggcggcgcgggctacatggccgagaacaggttgatcgggctgcgcggtgacacc
gacgtcttcaccacgttcgagggcgacaatcacgtgctgacccagctggtggccaaggaa
ctgctgaccgcgtacgccgacgacatcaagagcatgagcccggtcgaatgggtgcgcttt
gccgccaacaccgtcggtgaacgcgtcatcaaacgcactgcggcggaagcgattatccaa
acgatcgtggactcccgccaggacagcgaggaagagggcagcctgttcaatcgcggcacg
cagatcaagatgttcgaagaccgcgaggaatacctgctggcgtcggtggcgcgccggctg
caggcgaaatccaaagagatgtcggaattcgacgcgttcaactcggtgcaggaccacgtg
ctgcacgcggcgagcgcccacatcgaccgcgtggtgctcgaagcgttcgtcgccgggatc
gacggctgcgcgaacgaggaggcccgcgagctgttggggatcctgtgcgacctgtacgcg
ttgtcggtgatcgaggacgacaaggcgtggtacatcgagcaccggtacctgtccaccgag
cgcgccaaggccgtcacgcggggaatcaacgaccgctgccgggcgctgcgcccgcacgcc
gcgacactggtcgacggcttcggggttcccgagcaactgcgttacgccgagatgctgcac
ccggagaacttggcggacgccgtcacaagctga

DBGET integrated database retrieval system