KEGG   Mycobacterium chimaera: AN480_23095Help
Entry
AN480_23095       CDS       T04926                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AN480_23095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mchi03400]
    AN480_23095
Enzymes [BR:mchi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AN480_23095
DNA repair and recombination proteins [BR:mchi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AN480_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: APD84372
UniProt: A0A220YIF5
Position
5066390..5069692
Genome map
AA seq 1100 aa AA seqDB search
MPLHLHRAERTDLLADGLGALLADPPADPFAPELVVVPARGVERWLSQRLSHVLGRARGG
GVSGGVCAGVSFRSPGSLIAEIAGTADDDPWSPEAMAWPLLEAIDHSLDEPWCRPLATHV
GHFHTGAEAELRRGRRYEVARRLAGLFASYARQRPQLLIDWLGGDPGDLDEDLRWQPELW
RALVSRVAADPPHIRHAKTLARLSEAPSDLPARLSLFGHTRLSRTDSELLAALAIHHELH
LWLPHPSDRLWRALAGTRGAIPRREDTSHRAVGHPLLATLGRDLRELQRGLPADAQTDEY
LPGEARPDTLLGWVQSDIAANAVRPQGRALADDDRSVQIHNCHGPARQVDVLREVLLGLL
ADDPTLEPRDILVMCPDIETYAPLIVADFGLGDVVHGAHPAHQLRVLLADRSLVQTNSLL
AVASQLLGLAGGRVTATEVLNLAQAAPVRARFGFTDDDLEAITRWVRQANIRWGLDQEHR
RPYHVDFVHNTWRFGIDRILAGVAMSDDSNAWIDATLPLDDVSSNRVPLAGQFAEFVARL
HHVVDSLTGTRTLTEWLATLAGAIASLTRVHESEEWQTGQVQREFAAVLAQAGSRGGTML
RLPDIRALLTRHLAGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGLFPRLGVVD
GDDALARRPMTGERDIRSEDRQLLLDAIGAATEKLVITYTGANEYSGQPRPPAVPLAELL
DALDVTTPTKVRHRIVIEHPLQPFDVRNVIPGELVPKVPFSFDPTVLRAARAATGEHTEQ
PKFVAAPLPPPPADDVNLADLVGFFKDPVKGFFRALEFTLPYDVDGVQDAMPVDINGLEE
WTVGDRMLGDILRGMSPDDARQAEWRRGTLPPGQLGWRKVTEIRDQAAALALEALRHRQD
HRSAAAYDVDVDLGAGRRLTGTVSPVYDDALVSVTYSRLDGKHLLESWIPLLALAAHDPG
RDWSAVCIGRMRRGRSIRVEGLGPPDGDPVEVLRELVTIYDAGRREPIPLPIKTSYAWAA
ARHGGDDPAAEARRRWKTSDRFPGEDQAPAHVRAWGRGAPLDDLMQPVRPGEECDGEDNR
LGAYAARLWLPMLRAERKLI
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttcatctgcaccgcgccgagcgcaccgatctgttggccgacgggctcggcgct
ctgctggccgatcccccggccgacccgttcgcccccgagctcgtcgtggtcccggcgcgc
ggggtggagcgctggctgagccagcggctgtcgcacgtgctcggtcgggcccgcggcggc
ggggtttccggcggggtgtgcgccggggtttcgttccgcagccccggctcgctgatcgcc
gagatcgccggcaccgccgacgacgatccgtggtcgccggaggccatggcgtggcccctt
ctggaggcgatcgaccactcgctggacgaaccgtggtgccgcccgctggcgacccatgtc
ggtcacttccacaccggcgcggaggccgagctgcgccgggggcgccggtacgaggtggcg
cgccggttggccgggctgttcgcctcctacgcacggcagcgcccgcaactgctgatcgac
tggctgggcggcgacccgggcgatctcgatgaggacctgcgctggcagccggagctgtgg
cgggcgctggtgtcgcgggtcgcggccgatcccccgcacattcgccacgccaagaccctc
gcgcggctgtccgaggcgcccagtgacctgcccgcgcggctgtcgctgttcgggcacacc
cggttgtcgcgcaccgactccgagctgctggccgccctggccatccaccacgagctgcac
ctgtggctgccgcaccccagcgaccggctgtggcgcgcgctggccggcacgcgcggggcg
atcccccgccgcgaggacaccagccaccgcgccgtgggccacccgctgctcgccaccctg
gggcgggacctgcgcgagctgcagcgcggcctgccggcggacgcgcagaccgacgagtac
ctgcccggcgaggcgcgcccggacacgctgctcggctgggtgcagtccgacatcgccgcc
aacgccgtgcggccgcaggggcgcgcgctggccgacgacgaccggtcggtccagatccac
aactgccacggcccggcccgccaggtcgatgtgctgcgcgaggtgctgctcggcctgctg
gccgacgacccgacgctcgaaccgcgcgacatcctggtgatgtgcccggacatcgaaacc
tatgcgccgctgatcgtggccgacttcggcctgggcgacgtggtgcacggcgcgcatccc
gcccaccagctacgggtgctcctggcggatcgctcactggtccagaccaattcgctgctg
gctgtggcctcccaactgctggggctcgccggcggcagggtgacggccaccgaggtgctc
aacctggcacaggccgccccggtgcgcgcccggttcgggttcaccgacgacgatctggag
gccatcacccgctgggtgcggcaggccaacatccggtggggattggaccaggagcaccgg
cggccctaccacgtcgacttcgtgcacaacacctggcgtttcggcatcgaccggatcttg
gccggcgtcgcgatgtccgacgattcgaacgcatggatcgacgcgacgctgccgctcgac
gacgtgagcagcaaccgggtcccgttggccggccagttcgccgaattcgtcgcccggctg
caccacgtggtcgactccctcaccggcacaaggacattgaccgagtggctggccaccctc
gccggcgccatcgcctcgttgacgcgggtgcacgagtccgaggagtggcagaccggtcag
gtgcaacgggagttcgccgcggtcctggcgcaggccgggtcacggggcggcacgatgctg
cgactgcccgacatccgcgcgctgctgacccggcacctcgccgggcgccccacgcgggcc
aacttccgcaccggcacgctgacggtgtgcaccatggtcccgatgcgctcggtcccccac
cgggtggtgtgcctggtcggcctggacgacgggctgttcccgcgtctcggtgtcgtcgac
ggggacgacgcgctggcccgccgcccgatgaccggggaacgcgacatccgttcggaggac
cggcaattgctgctcgacgcgatcggcgccgccaccgagaaactggtgatcacgtacacc
ggcgccaacgaatattcggggcagccgcgcccacccgcggtgccgctggccgaattgctg
gacgccctcgacgtgacgacgccgacgaaggtgcgccaccgcatcgtgatcgagcatccg
ttgcagccgttcgacgttcgcaacgtcatccccggcgaactggtgccgaaggtgccgttc
agtttcgaccccacggtgctgcgcgcggcgcgcgcggccaccggcgaacacaccgaacaa
cccaaattcgttgcggcgccgctgccgcccccgccggccgacgacgtcaacctcgccgac
ctcgtcggcttcttcaaagacccggtgaagggcttcttccgcgccctggaattcacgctg
ccctacgacgtcgacggcgtccaagacgccatgccggtcgacatcaacggcctcgaggag
tggaccgtcggcgaccggatgctgggcgacatcctgcgcgggatgagccccgatgacgcg
cggcaggccgaatggcgccgcggcacactgccccccggccagctgggctggcgcaaggtc
accgagatccgcgaccaggccgccgcgctggcgctcgaggcgctgcggcatcggcaagac
caccgatcggccgccgcctatgacgtcgacgtcgacctgggcgccggtcgccggctcacc
ggcacggtgtcgccggtctacgacgacgccctggtgtcggtgacctattcgaggctggac
ggcaagcacctgctcgaatcgtggattccgttgctggcgttggccgctcacgaccccggc
cgcgactggtcggcggtgtgcatcggccggatgcgccgcggcagaagcatccgggtcgag
gggctggggccaccggacggcgatcccgtcgaggtgctgcgcgagctggtgacgatctac
gacgcgggacggcgggaaccgatcccgttgcccatcaagacgtcctacgcgtgggcggcg
gcccggcacggcggcgacgacccggcggccgaggcgcggcgccggtggaagaccagcgac
cgcttcccgggtgaggaccaggcgccggcgcacgtgcgggcgtgggggcgcggcgcgccg
ttggacgatctgatgcagccggtgcggccgggcgaggagtgcgacggcgaggacaaccgg
ctcggcgcgtatgcggcccggctgtggctgccgatgctgcgcgccgagcggaagctcatc
tga

DBGET integrated database retrieval system