KEGG   Mycolicibacterium chitae: MCHIJ_01390
Entry
MCHIJ_01390       CDS       T06603                                 

Gene name
echA5
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_01390 (echA5)
   00650 Butanoate metabolism
    MCHIJ_01390 (echA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_01390 (echA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_01390 (echA5)
   00310 Lysine degradation
    MCHIJ_01390 (echA5)
   00360 Phenylalanine metabolism
    MCHIJ_01390 (echA5)
   00380 Tryptophan metabolism
    MCHIJ_01390 (echA5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_01390 (echA5)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_01390 (echA5)
   00281 Geraniol degradation
    MCHIJ_01390 (echA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_01390 (echA5)
   00627 Aminobenzoate degradation
    MCHIJ_01390 (echA5)
   00930 Caprolactam degradation
    MCHIJ_01390 (echA5)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_01390 (echA5)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ00702
Position
complement(124076..124804)
AA seq 242 aa
MTTVIMNRPQARNAVNGPAAAELFAAFEEFDADDAASVAVLWGDGGTFCAGADLKAFGTP
ESNRTEPDGPGPMGPTRMNLSKPVIAAVSGYAVAGGLELALWCDLRIAEADAVFGVFCRR
WGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAQEALAIGLANRVVPKGQARQAAEELA
AELATLPQGCLRADRASAIQQWGMTETDAMADEFTSLSRVAAESLRGARRFADGAGRHGR
RA
NT seq 729 nt   +upstreamnt  +downstreamnt
gtgaccaccgtcatcatgaaccggccgcaggcccgcaacgcggtcaacggcccggccgcc
gcggagctgttcgcggccttcgaggagttcgacgccgacgacgcggcgtcggtggcggtg
ctctggggtgacggcggaaccttctgcgccggagccgatctcaaggccttcggcaccccg
gagtccaatcggaccgaaccggacgggcccgggccgatggggcccacccggatgaacctg
tcgaagccggtgatcgccgccgtcagcggctacgcggtggccggcggcctcgagttggcg
ctgtggtgcgatctgcgcatcgccgaagccgacgcggtgttcggggtcttctgccggcgt
tggggagttccgctgatcgacggcggcacggtgcggctgccgcggctgatcgggcacagc
cgggcgatggacctgatcctgaccggccgcgccgtcgacgcgcaggaggccctcgccatc
ggcctggccaaccgtgtcgtgccgaaaggccaagcgcggcaggccgccgaggagctggcc
gccgaactcgccacactgccccagggctgcctgcgcgccgaccgcgcctcggcgatacag
cagtgggggatgaccgagaccgacgccatggccgacgaattcaccagtctgtcgcgggtg
gcggccgaatcactgcgcggtgcacgacgtttcgccgacggcgcgggccggcacggccgg
cgggcgtga

KEGG   Mycolicibacterium chitae: MCHIJ_01710
Entry
MCHIJ_01710       CDS       T06603                                 

Gene name
echA3
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_01710 (echA3)
   00650 Butanoate metabolism
    MCHIJ_01710 (echA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_01710 (echA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_01710 (echA3)
   00310 Lysine degradation
    MCHIJ_01710 (echA3)
   00360 Phenylalanine metabolism
    MCHIJ_01710 (echA3)
   00380 Tryptophan metabolism
    MCHIJ_01710 (echA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_01710 (echA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_01710 (echA3)
   00281 Geraniol degradation
    MCHIJ_01710 (echA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_01710 (echA3)
   00627 Aminobenzoate degradation
    MCHIJ_01710 (echA3)
   00930 Caprolactam degradation
    MCHIJ_01710 (echA3)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_01710 (echA3)
SSDB
Motif
Pfam: ECH_1 ECH_2 CLP_protease Peptidase_S49 Tlp
Other DBs
NCBI-ProteinID: BBZ00734
Position
157663..158361
AA seq 232 aa
MSDPVTYRHDDSIAVITLDDGKANVLGPRMQEAIGAALDRAESDGVGAIVLAGNQKVLSG
GFDLKVFQSGDPQAALAMLQGGFELTHRLLSFPKPVVIACTGHAIAMGAFLLCSGDHRIA
APGYNIQANEVAIGMVMPYAALEVMKLRLTPSARQQATGLAKAYFGEAAQAAGWIDEIAL
PEAVLERAEESAREFANLHQRAHHESKLRARADALAGIRAGIDNMAAELGLT
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcgacccggtgacctaccgccatgacgattcgatcgccgtgatcaccctcgacgac
ggcaaggccaacgtgctcggcccgcgcatgcaggaggccatcggtgcggcactggaccgc
gccgagagcgacggggtcggcgcgatcgtgctcgccggcaaccagaaggtgctcagcggc
ggcttcgacctcaaggtgttccagtcgggcgatccgcaggcggcgctggccatgctccag
ggcgggttcgaactgacgcaccgactgctgtcgttccccaagccggtggtgatcgcctgc
accggtcacgcgatcgccatgggcgcgttcctgctgtgcagcggcgatcaccgaattgcc
gcccccggctacaacattcaggccaacgaggtcgccatcggcatggtgatgccgtacgcc
gcgctcgaggtcatgaagctgcggctgaccccgtcggcccgccagcaggcgacgggcctg
gccaaggcgtacttcggcgaggccgcgcaggccgccggctggatcgacgagatcgcgctg
cccgaggcggtgctcgagcgggccgaggagtccgcgcgcgagttcgccaacctgcaccag
cgcgcccatcacgagtcgaaactgcgggcccgtgccgacgcgctggcgggcatccgggcc
ggcatcgacaacatggcggccgaactcggcctgacctga

KEGG   Mycolicibacterium chitae: MCHIJ_02140
Entry
MCHIJ_02140       CDS       T06603                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01200  Carbon metabolism
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_02140
   00650 Butanoate metabolism
    MCHIJ_02140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_02140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_02140
   00310 Lysine degradation
    MCHIJ_02140
   00380 Tryptophan metabolism
    MCHIJ_02140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_02140
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_02140
   00281 Geraniol degradation
    MCHIJ_02140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_02140
   00930 Caprolactam degradation
    MCHIJ_02140
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCHIJ_02140
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_02140
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCHIJ_02140
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO NAD_binding_8
Other DBs
NCBI-ProteinID: BBZ00777
Position
204473..206635
AA seq 720 aa
MTAENTIAWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNTVQRLVAEKDSITGVVITS
AKKTFFAGGDLKDLIAVDKDKAAEFFADVEATKADLRTLETAGIPVVAAINGAALGGGLE
IALACHHRIAADVRGSVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFTEILSQGTRFNPT
KALEIGLIDELVGSVDELVPAAKAWIQQELDANPEGAAVQPWDAKGYKMPGGTPATPALA
AILPSFPALLKKQAKGSPTPAPRAILNAAVEGAQVDFDTASRIESRYFTSLVTGQTAKNM
IQAFFFDVQAINGGASRPDGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSLE
AAQKGKAYSEGLEAKALKRGKTTEEKSAALLAKITPTADAADLKGVDFVIEAVFENTELK
HKVFGEIEDIVEPNAILGSNTSSLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGE
KTSDEALARVFDYTLAIKKTPIVVNDSRGFFTSRVITTFLNEAMAMLGEGVDPVSIEQAG
GQAGYPAPPLQLLDELNLELLQKVSDENRKAAEAAGTEYRPHPGDAIVDKMIEIGRPSRL
KGAGFYSYVDGKRVGLWPGLKETFNSGSSDIPLQDMIDRMLFAEALETQKCLDEGVLTST
ADANIGSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGDRFAPPESLV
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgacagctgagaacactattgcgtgggacaaggatgccgacggcatcgtcacgttgacg
ttggatgatccgaccggatcggccaacgtgatgaacgagcactacaaggaatcgatgcac
aacaccgtgcaacgccttgtggccgaaaaagattcgatcaccggtgtggtcatcaccagc
gcgaagaagaccttcttcgccggcggcgacctcaaggacctcatcgcggtcgacaaggac
aaggccgcggagttcttcgccgacgtcgaggcgacgaaggccgacctgcggaccctcgag
acggccggcatccccgtggtcgccgccatcaacggcgctgccctcggcggcggcctggag
atcgcgctggcctgtcatcaccgcatcgccgccgacgtgcgcggctcggtgatcggcctg
cccgaggtcaccctgggcctgctgcccggcggtggcggcgtggcccgcacggtccggatg
ttcggcatccagaaggcgttcaccgagatcctgagccagggcacccggttcaaccccacc
aaggcgctcgagatcggactgatcgacgagttggtgggctcggtggacgaactcgttccg
gccgccaaggcgtggatccagcaagagctcgacgccaacccggagggtgccgccgtgcag
ccgtgggatgccaagggctacaagatgcccggcggcacccccgccactccggcgctggcc
gcgatcctgccgtcgttcccggcgctgctcaagaagcaggccaagggatccccgaccccc
gcgccgcgcgccatcctcaacgccgcggtcgagggcgcccaggtcgacttcgacaccgcc
agccgcatcgagagccgctacttcacgtcgttggtgaccggccagaccgccaagaacatg
atccaggcgttcttcttcgacgtgcaggccatcaacggcggcgcgtcgcgccccgacggc
atcgccaagcaggacatcaagaagatcggcgtgctcggtgcgggcatgatgggcgccggt
atcgcctacgtgtcggccaaggccggctacgacgttgtgctcaaggacgtcagcctcgag
gcagcccagaagggcaaggcctactcggagggcctggaagccaaggcgctcaagcgtggc
aaaaccaccgaggagaagtctgcggcgttgctggccaagatcaccccgaccgccgatgcc
gcggacctcaagggcgtcgacttcgtcatcgaggcggtcttcgagaacaccgaactcaag
cacaaggtgttcggtgagatcgaggacatcgtcgaacccaacgccatcctcggctcgaac
acctccagcctgccgatcacgggcttggccaccggcgtcaagcgccaggaggacttcatc
gggatccacttcttctcccccgtcgacaagatgcccctcgtcgagatcatcaagggcgaa
aagacttccgacgaggcgctggcccgggtgttcgactacaccctggccatcaagaagacc
ccgatcgtcgtcaacgacagccgcggcttcttcaccagccgggtgatcaccacgttcctc
aacgaggcgatggcgatgctcggcgagggcgtcgatcccgtcagcatcgagcaggccggc
ggccaggctggctaccccgcgcccccgttgcagctgctcgacgagctcaacctggaactg
ctgcagaaggtttccgacgagaaccgcaaggccgccgaggccgcgggtaccgagtatcgg
ccgcatcccggggacgccatcgtcgacaagatgatcgagatcggtcgtccgtcgcgactc
aagggtgcgggcttctactcctacgtcgacggcaagcgcgtcggcctgtggcccgggctg
aaggagaccttcaactcaggaagctcggatatcccgctgcaggacatgatcgaccggatg
ctcttcgccgaggccctcgagacccagaagtgcctcgacgagggcgtgctgacctcgacc
gccgacgcgaacatcggctccatcatgggcatcggcttcccgccgtacaccggtggtagc
gcgcagttcatcgtcggctatcagggcgagctcggcgtcggcaaggaagccttcgtcgcc
cgcgccaagcaactggccgagcgttacggcgaccgcttcgccccgccggaatcgctggtg
taa

KEGG   Mycolicibacterium chitae: MCHIJ_07150
Entry
MCHIJ_07150       CDS       T06603                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_07150 (echA1)
   00650 Butanoate metabolism
    MCHIJ_07150 (echA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_07150 (echA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_07150 (echA1)
   00310 Lysine degradation
    MCHIJ_07150 (echA1)
   00360 Phenylalanine metabolism
    MCHIJ_07150 (echA1)
   00380 Tryptophan metabolism
    MCHIJ_07150 (echA1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_07150 (echA1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_07150 (echA1)
   00281 Geraniol degradation
    MCHIJ_07150 (echA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_07150 (echA1)
   00627 Aminobenzoate degradation
    MCHIJ_07150 (echA1)
   00930 Caprolactam degradation
    MCHIJ_07150 (echA1)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_07150 (echA1)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ01278
Position
complement(719220..719996)
AA seq 258 aa
MSDESNEPAVLVEQRDRILVITINRPKAKNAVNLAVSQGLADAMDRLDEDPGLSVGVLTG
AGGSFCAGMDLKAFARGERCDIEGRGLGFTESPPAKPLIAAVEGYALAGGTEVALATDLI
VAARDSAFGIPEVKRGLVAGGGGLLRLPQRIPYAIAMELALTGDNLSAERAHELGLVSVL
AEPGGALDAAIALAGKITANGPLAVAATKKIIVEARYWGPEEQWAEQMKILGPVFMSKDA
QEGAVAFAEKRAPKWTGT
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgagcgacgaatcgaacgaacccgcagtcctggtcgaacagcgcgaccggatcctggtc
atcaccatcaaccggcccaaggccaagaacgccgtcaacctcgccgtcagccaggggttg
gccgacgcgatggaccggctcgacgaggaccccggcctgtcggtcggcgtgctcaccggt
gcgggtgggtcgttctgcgcgggtatggacctcaaggcgttcgcccgcggcgagcgctgc
gacatcgagggccgcggcctgggcttcaccgagtccccgccggccaagccgctgatcgcc
gcggtcgaggggtacgcgttggccggtggcaccgaggtggcgttggcgacggatctgatt
gtcgcggcgcgtgattcggcgttcggcatccccgaggtcaagcgcggtctggtggccggc
ggcggcgggctgctgcgcctgccccagcgcattccgtacgccatcgcgatggaactcgcg
ctgaccggcgacaacctgtccgccgagcgggcccacgagttgggtctggtcagcgtgctg
gccgagccgggcggcgcgctcgacgccgcgatcgcgctggccgggaagatcaccgccaac
ggtccgctggccgtcgcggcaaccaagaagatcatcgtcgaggcgcgctactggggaccc
gaggagcagtgggccgaacagatgaagatcctgggcccggtgttcatgtccaaggatgcc
caggagggtgccgtcgccttcgccgagaagcgcgcccccaagtggacgggcacctga

KEGG   Mycolicibacterium chitae: MCHIJ_10480
Entry
MCHIJ_10480       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_10480
   00650 Butanoate metabolism
    MCHIJ_10480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_10480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_10480
   00310 Lysine degradation
    MCHIJ_10480
   00360 Phenylalanine metabolism
    MCHIJ_10480
   00380 Tryptophan metabolism
    MCHIJ_10480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_10480
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_10480
   00281 Geraniol degradation
    MCHIJ_10480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_10480
   00627 Aminobenzoate degradation
    MCHIJ_10480
   00930 Caprolactam degradation
    MCHIJ_10480
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_10480
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ01611
Position
1067195..1068184
AA seq 329 aa
MTEQAAQDAPPKASPSAEDIVLYEKDPKTKIATITLDRADELNAMTIDAQHRYADLIHYA
GVDDDVKVLVIRANGPNLGSGADLAELMDTMAGRGEGTMNHAVRVPEDADVVYPPEGTYR
RRATTVQYYTDPSAGMRSLQDFKKISILEVRGYCYGWHFYQAADADIVIASDDSLFGHAA
WRYAGFAARQWQWCNTMGARKFMEMVFTGRPFTAKEMYDCNFINAVVPFDELEAMTEKYA
LACSRSRPTDTVFAQKTFFEIYKQHQGEYMGSVVAGLLESTLDALRPDPQTNSMELDEAT
LGRLTDTVRDNDGQFPPDWRLSRRGRAAT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaccgagcaggcggcgcaggatgcgccacccaaggccagcccttccgccgaagacatc
gtgctgtacgagaaggacccgaagaccaagatcgcgacgatcacgctcgaccgcgccgat
gaactcaacgcgatgaccatcgacgcccagcaccgctacgccgacctgatccactacgcc
ggtgtcgacgacgacgtgaaagtgctggtcatccgggccaacgggcccaacctgggcagc
ggggccgacctcgcggaactgatggacaccatggccggccgcggcgagggcaccatgaac
cacgccgtgcgcgtgcccgaggacgccgatgtggtgtacccgccggagggcacctaccgc
cgccgcgcgaccacggtccagtactacaccgacccgagcgccggcatgcgcagcctccag
gacttcaagaagatcagcatcctggaggtgcgcggttactgctacggctggcacttctat
caggccgccgacgccgacatcgtgatcgcctccgacgactccctgttcggccacgccgca
tggcgctacgcgggattcgcggcccggcagtggcagtggtgcaacaccatgggtgcgcgc
aagttcatggagatggtgttcacgggacggcccttcaccgccaaggaaatgtacgactgc
aacttcatcaacgccgtcgtgcccttcgacgaactcgaagcgatgacggagaagtacgcg
ctggcctgttcgcggagccggcccaccgacaccgtgttcgcccagaagaccttcttcgag
atctacaagcagcaccagggcgaatacatgggcagcgtcgttgccggattgctcgaatcc
acgctcgatgcgctgcggcctgacccccagacgaactcgatggaactcgacgaagcgacc
ctgggccgcctcaccgacaccgtccgtgacaacgacgggcaatttcccccggactggcga
ttgagccggcggggccgggctgcaacgtag

KEGG   Mycolicibacterium chitae: MCHIJ_17010
Entry
MCHIJ_17010       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_17010
   00650 Butanoate metabolism
    MCHIJ_17010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_17010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_17010
   00310 Lysine degradation
    MCHIJ_17010
   00360 Phenylalanine metabolism
    MCHIJ_17010
   00380 Tryptophan metabolism
    MCHIJ_17010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_17010
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_17010
   00281 Geraniol degradation
    MCHIJ_17010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_17010
   00627 Aminobenzoate degradation
    MCHIJ_17010
   00930 Caprolactam degradation
    MCHIJ_17010
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_17010
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02264
Position
complement(1765440..1766264)
AA seq 274 aa
MADSYESLSVEIDGHIAQVTLLGPGKGNTMGPAFWAELPVAFEALDADPQVRAIVLTGSG
KHFSYGLDLAASSDFLGPLMAEGAMAGPRAAFHRHLKGMQQSITAVADCRTPIIAAVQGW
CIGGGVDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLPLILNDGHLRELALTGKD
IDAKRAEKIGLVNDVFDDAEATLAAARATAAEIAANPPLTVQGIKDVLDEQRTAQVAASL
RYVAAWNSAFLPSKDLTEGVTAMFQKRPPEFKGE
NT seq 825 nt   +upstreamnt  +downstreamnt
atggctgacagctacgaatccctctcggtcgagatcgacggtcacatcgcgcaggtgacg
ctgctcggtccgggcaagggcaacacgatgggcccggcgttctgggccgaactgccggtg
gcgttcgaggccctcgatgccgacccgcaggtgcgggcgatcgtgctgacgggctcgggc
aagcacttcagctacggcctggatctggccgcctccagtgacttcctcgggccgctgatg
gccgagggcgccatggccggcccgcgcgcggcgttccaccgccacctgaagggcatgcag
cagtccatcaccgcggtcgccgattgccgcaccccgatcatcgccgcggtgcagggctgg
tgcatcggcggtggcgtcgacctgatcagcgccgtcgacatccgctacgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctggccatcgtcgccgacgtcggcagcctcgcg
cgcctgccgctgatcctcaacgacggacacctgcgcgaactggcgctgacgggcaaggac
atcgacgccaagcgggccgagaagatcggtctggtcaatgacgtcttcgacgacgccgag
gccacgctggccgccgcgcgggccaccgcggccgagatcgccgccaatccgcccctgacc
gtgcagggcatcaaggatgtgctcgacgagcagcgcaccgcccaggtcgcggccagcctg
cgttacgtggcggcctggaactcggcgttcctgccgtcgaaggatctgaccgagggcgtc
accgcgatgttccagaagcgcccgccggagttcaagggcgaatag

KEGG   Mycolicibacterium chitae: MCHIJ_19620
Entry
MCHIJ_19620       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_19620
   00650 Butanoate metabolism
    MCHIJ_19620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_19620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_19620
   00310 Lysine degradation
    MCHIJ_19620
   00360 Phenylalanine metabolism
    MCHIJ_19620
   00380 Tryptophan metabolism
    MCHIJ_19620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_19620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_19620
   00281 Geraniol degradation
    MCHIJ_19620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_19620
   00627 Aminobenzoate degradation
    MCHIJ_19620
   00930 Caprolactam degradation
    MCHIJ_19620
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_19620
SSDB
Motif
Pfam: ECH_1 ECH_2 DcrB
Other DBs
NCBI-ProteinID: BBZ02525
Position
complement(2020810..2021565)
AA seq 251 aa
MTITTQTVEPGIVSVTVNYPPVNAIPSAGWFELADAITAAGRDRSTHVVILRAEGRGFNA
GVDIKEMQNTEGFTALIDANRGCYAAFKAVYECEVPVIAAVNGFCVGGGIGLVGNADVIV
ASDDAKFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAETLHHFGSVHEVVPRA
ELDESALRVARDIASKDTRVIRAAKEALNFIDVQPVNARYRMEQGFTFELNLSGVSDEHR
DAFAGTDKGSK
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacgatcaccacccagacagtcgaaccgggcatcgtctcggtcaccgtcaactacccg
ccggtcaacgccatcccgtcggccggctggttcgaactcgccgacgccatcactgcggcc
gggcgggaccgcagcacccacgtggtgatcctgcgggcggagggccgcggcttcaacgcc
ggcgtggacatcaaggagatgcagaacaccgagggcttcaccgcgctgatcgacgccaac
cgcggctgctacgcggccttcaaggcggtctacgaatgcgaggtcccggtgatcgccgcg
gtcaacggcttctgcgtcggcggcggcatcggcctggtcggcaacgccgacgtcatcgtc
gcctccgacgacgccaagttcggcctccccgaggtggaacgcggcgcgctcggcgcggcc
acccacctgtcccggctggtgccccagcatctgatgcgtcggctgttcttcaccgcggcc
accgtggacgcggagaccctgcaccacttcgggtcggtgcacgaggtggtgccccgcgct
gaactcgacgagtccgcgctgcgcgtcgcccgcgatatcgcgagcaaggacacccgggtg
atccgggccgccaaggaggcgctgaacttcatcgacgtacagcccgtcaacgcgagatac
cgcatggagcagggcttcaccttcgaactcaacctgtccggtgtctccgacgagcaccgc
gacgccttcgccggcactgacaagggatccaagtga

KEGG   Mycolicibacterium chitae: MCHIJ_20150
Entry
MCHIJ_20150       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_20150
   00650 Butanoate metabolism
    MCHIJ_20150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_20150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_20150
   00310 Lysine degradation
    MCHIJ_20150
   00360 Phenylalanine metabolism
    MCHIJ_20150
   00380 Tryptophan metabolism
    MCHIJ_20150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_20150
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_20150
   00281 Geraniol degradation
    MCHIJ_20150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_20150
   00627 Aminobenzoate degradation
    MCHIJ_20150
   00930 Caprolactam degradation
    MCHIJ_20150
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_20150
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02578
Position
complement(2111792..2112619)
AA seq 275 aa
MQEGGSIVSDAESAAEQPHALVEQRGHTLIVTMNRPERKNALTGEMLSIMVDAWDRVDND
PEIRSCVLTGAGGAFCAGMDLKNANKQAPGDTFKAGYDPTRIDGLLKGRRLTKPLIAAVE
GAAIAGGTEILQGTDIRVAGESAKFGVSEAKWSLYPMGGSAVRLVRQIPYTIACDILLTG
RHITAAEAREFGLIGHVVPDGSALDKALEIAEVINNNGPLAVQAILKTIRETEGMHENDA
FVPDTKNGIPVFLSEDSKEGPRAFAEKRKPNFQMK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcaggaaggcgggtccatcgtgagcgatgctgagagtgctgccgaacagccgcatgcc
ctggtagagcagcgcggacacacgctgatcgtcacgatgaaccggccggagcgcaagaac
gccctcaccggtgagatgctctcgataatggtcgacgcctgggaccgcgtcgacaacgat
ccggagatccggagttgcgtcctgaccggggccggcggcgcgttctgcgcgggcatggac
ctgaagaacgccaacaagcaggccccgggcgacaccttcaaggccggctacgaccccacc
cgcatcgacggcctgctcaagggccgccggttgaccaagccgctgatcgccgccgtcgag
ggcgccgcgatcgccgggggcaccgagatcctgcagggcaccgacatccgggtggccggc
gagagcgccaagttcggggtgtccgaggccaagtggagcctgtacccgatgggcgggtcc
gcggtgcgcctggtccggcagatcccgtacacgatcgcctgcgacatcctgctgaccgga
cggcacatcaccgccgccgaggcccgcgagttcggcctgatcggccatgtcgtgccggac
ggttcggcgctggacaaggcgctcgagatcgccgaggtcatcaacaacaacggccccttg
gcagtacaggccatcctgaagaccatccgggagaccgagggcatgcacgagaacgacgcc
ttcgtccccgacaccaagaacggcatcccggtgttcctctccgaggactccaaggagggc
ccgcgcgcgttcgccgagaagcgcaagccgaacttccagatgaagtag

KEGG   Mycolicibacterium chitae: MCHIJ_20370
Entry
MCHIJ_20370       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_20370
   00650 Butanoate metabolism
    MCHIJ_20370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_20370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_20370
   00310 Lysine degradation
    MCHIJ_20370
   00360 Phenylalanine metabolism
    MCHIJ_20370
   00380 Tryptophan metabolism
    MCHIJ_20370
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_20370
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_20370
   00281 Geraniol degradation
    MCHIJ_20370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_20370
   00627 Aminobenzoate degradation
    MCHIJ_20370
   00930 Caprolactam degradation
    MCHIJ_20370
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_20370
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02600
Position
2135522..2136457
AA seq 311 aa
MATPQQTDSTPPAGGTPEFVTYETLDSGRIARVWLNRPAEHNAQNRTLLVQLDEAFRRAE
ADDEVRVIILAARGKNFSAGHDLGSEAALAERTPGPGMHPSYASDGATRPGMVEKLYLQE
WHYYFENTCRWRDLRKITIASVQGNAISAGLMLMWACDLIVAADNAKFSDVVATRLGMPG
VEYFGHPWEFGPRKAKELLLTGDSIDAEEGYRLGMVSKVFPVDELEDKTLEFARRIAERP
TMAALLVKDSVNAASDAMGFSEALRHAFHIHELGHAHWAAHNENRFPVAQAPDVEDWRTA
KPTQPARKDIP
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgacgccccagcagaccgacagcactcctccggccggcggtaccccggagttcgta
acctacgagaccctcgattccggccggatcgcgcgggtctggctcaaccgcccggccgag
cacaacgcccagaaccggaccctgttggtccagctcgacgaggccttccgccgggccgag
gccgacgacgaggtccgggtgatcatcctggccgcgcgcggcaagaacttctccgccggg
cacgacctgggctccgaggcggccctggccgaacgcacccccgggcccggcatgcatccg
agctacgcgtccgacggtgccacccggccgggcatggtggagaagctctacctgcaggaa
tggcactactacttcgagaacacctgccgctggcgggacctgcgcaagatcaccatcgcc
tcggtgcagggcaacgcgatctccgcgggcctgatgctgatgtgggcctgcgatttgatc
gtcgccgccgacaacgccaagttcagcgacgtcgtggccacccggctgggcatgcccggc
gtcgagtacttcggccacccgtgggagttcggcccgcgcaaggccaaggagctgctgctc
accggcgactcgatcgacgccgaggagggctaccgcctgggcatggtctcgaaggtgttc
ccggtcgacgagctcgaggacaagacgctggagttcgcccggcgcatcgccgagcggccg
acgatggcggcgctgctggtcaaggattcggtgaacgcggcctccgacgcgatggggttc
agcgaggcgctgcggcatgcgttccacatccacgaactcggccacgcccactgggccgcc
cacaacgagaaccgcttcccggtggcgcaggcgcccgacgtcgaggattggcggaccgcc
aagcccacccaaccggcccgcaaggacattccctga

KEGG   Mycolicibacterium chitae: MCHIJ_20990
Entry
MCHIJ_20990       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_20990
   00650 Butanoate metabolism
    MCHIJ_20990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_20990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_20990
   00310 Lysine degradation
    MCHIJ_20990
   00360 Phenylalanine metabolism
    MCHIJ_20990
   00380 Tryptophan metabolism
    MCHIJ_20990
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_20990
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_20990
   00281 Geraniol degradation
    MCHIJ_20990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_20990
   00627 Aminobenzoate degradation
    MCHIJ_20990
   00930 Caprolactam degradation
    MCHIJ_20990
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_20990
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02662
Position
2194911..2195792
AA seq 293 aa
MTTADDRVLFEVDRDQRIATITLNNPAQRNSYDAGMRDALARHLDVVAEDDDLTVVLLRG
AENVFSTGADMNNAYGWYGEKGKNDAPPAKSRPSQRRRLTVDRKSFGFYHNLMGFPKVTV
GEINGFALGGGFEMALMMDISVIGRDTRIGMPATRFLGPALGSLHMFFHRLGPVLARRLL
LTGDIIEAGEIEQLGIFTETCAPEKVAARARYWAQKTAKMPADGVVIAKEAFRLVEQSQA
YQGEEVASYIFHAYGTNLQFAPGEFNFVKTRAQHGTKEAFRLRDEHFHVPEPE
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacgaccgcagatgaccgcgtgctcttcgaggttgatcgcgaccagcgcattgccacc
atcacgctgaacaatccggcgcagcgcaactcgtatgacgccggcatgcgggacgccctg
gcgcgccacctcgacgtggtcgccgaggacgacgacctgaccgtggtgctgctgcgcggc
gccgagaacgtcttcagcaccggcgccgacatgaacaacgcgtacggctggtacggggag
aaaggcaagaacgacgccccgccggccaagtcacggcccagccagcgtcgtcgactcacc
gtggaccgcaagtcttttggcttctaccacaatctgatgggcttcccgaaggtgacggtc
ggggagatcaacggcttcgccctgggcggcggcttcgagatggccctgatgatggacatc
tcggtgatcgggcgcgacacccgaatcggtatgcccgccacccggttcctgggcccggcg
ctgggcagcctgcacatgttcttccaccggttggggccggtgctggcccggcgcctgttg
ttgaccggcgacatcatcgaggccggcgagatcgaacagctgggcatcttcaccgagacc
tgcgcgccggagaaggtggcggcgcgcgcgcgctactgggcgcagaagaccgccaagatg
ccggccgacggcgtggtgatcgccaaggaggccttccggctcgtcgagcagagccaggcc
taccagggcgaggaagtcgccagctacatcttccacgcctacggcacgaacctgcagttc
gcgccgggggagttcaacttcgtcaagacccgcgcgcagcacgggacgaaggaagcattc
cggttgcgggacgagcactttcacgtccccgaaccggagtga

KEGG   Mycolicibacterium chitae: MCHIJ_22220
Entry
MCHIJ_22220       CDS       T06603                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01200  Carbon metabolism
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_22220
   00650 Butanoate metabolism
    MCHIJ_22220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_22220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_22220
   00310 Lysine degradation
    MCHIJ_22220
   00380 Tryptophan metabolism
    MCHIJ_22220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_22220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_22220
   00281 Geraniol degradation
    MCHIJ_22220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_22220
   00930 Caprolactam degradation
    MCHIJ_22220
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCHIJ_22220
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_22220
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCHIJ_22220
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO NAD_binding_8 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: BBZ02785
Position
2317413..2319563
AA seq 716 aa
MTVENTIAWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNTVQRLVAEKDSITGVVITS
AKKTFFAGGDLKGMMTVGPDDAEASFAEVEFIKADLRQLETLGVPVVAAINGAALGGGLE
IALACHHRIAADVRGSVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEVLSQGTRFNPG
KAKEIGLVDELVGSVDELVPAAKAWIKANPEAHTQPWDAKGYKMPGGTPASPALAAILPS
FPALLKKQLKGSPMPAPRAILNAAVEGAQVDFDTASRIESRYFTSLVTGQTAKNMIQAFF
LDLQAINGGASRPEGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSLEAAQKG
KAYSEKIEAKALKRGKTTEERSAALLSKITPTADAADLKGVDFVIEAVFENQELKHKVFQ
EIEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDE
ALARVFDYTLAIKKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVNAASIEQAGAQAGY
PAAPLQLSDELNLELMQKIATETRKATEAAGGTHEAHPAEAVVNKMIEIGRPSRLKGAGF
YSYVDGKRVGLWEGLAETFNSGSSDIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANI
GSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGERFNPPASLTK
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgacagttgagaacactattgcgtgggacaaggatgccgacggcatcgtcacgttgacg
ttggatgatccgaccggatcggccaacgtgatgaacgagcactacaaggaatcgatgcac
aacaccgtgcaacgccttgtggccgagaaggattcgatcaccggtgtggtcatcaccagc
gcgaagaagaccttcttcgccggcggcgacctcaaaggcatgatgaccgtgggccccgac
gacgcggaagcgtcgttcgccgaggtcgagttcatcaaggccgacctgcgccagctggaa
acccttggggttccggtggttgcggcgatcaacggcgcggccctcggtggcggcctggag
atcgccctggcctgtcatcaccgcatcgccgccgacgtgcgcggctcggtgatcggcctg
cccgaggtcaccctgggcctgctgcccggcggtggcggcgtggcccgcaccgtgcggatg
ttcggcatccagaaggcgttcatggaggtgctgagccagggcacccggttcaacccgggc
aaggccaaggagatcggcctggtcgacgaactcgtcggctcggtggacgagttggtgccg
gccgccaaggcctggatcaaggccaaccccgaggcccacacccagccctgggatgccaag
ggctacaagatgcccggcggcacccccgccagcccggcgctcgcggcgatcctgccgtcg
ttcccggcgctgctcaagaagcagctcaagggttcgccgatgccggcaccgcgcgcgatc
ctcaacgccgcggtcgagggcgcccaggtcgacttcgacacggccagccgcatcgagagc
cgctacttcacgtcgttggtgaccggccagaccgccaagaacatgatccaggcgttcttc
ctggacctgcaggccatcaacggcggcgcgtcgcgccccgagggcatcgccaagcaggac
atcaagaagatcggcgtgctgggcgcgggcatgatgggcgccggtatcgcctacgtgtcg
gccaaggccggctacgacgttgtgctcaaggatgtttcgctcgaggcggcccagaagggc
aaagcctactccgagaagatcgaggccaaggcgctcaagcgtggcaaaaccaccgaggaa
cgatctgctgcgttgctttctaagatcaccccgaccgccgatgccgcggacctcaagggt
gtggacttcgtcatcgaggccgtgttcgagaaccaggaactcaagcacaaggtgttccag
gagatcgaggacatcgtcgagccgaacgcgctgctggggtccaacacctccacgctgccg
atcacgggtctggccaccggcgtcaagcgccaggaggacttcatcgggatccacttcttc
tcccccgtcgacaagatgcccctcgtcgagatcatcaagggcgagaagacttccgacgag
gcgctggcccgggtgttcgactacacgctggccatcaagaagaccccgatcgtcgtcaac
gacagccgcggcttcttcaccagccgcgtcatcggcaccttcgtcaacgaggcgctggcc
atgctcggcgagggcgtcaacgccgccagcatcgagcaagccggtgcccaggccggctac
ccggccgcgccgctgcagctgtccgacgagctcaacctcgagctcatgcagaagatcgcc
accgagacccgcaaggcgaccgaggcggctggcggcacccacgaggcgcaccccgccgag
gccgtcgtcaacaagatgatcgagatcggtcgtccgtcgcggctcaagggtgcgggcttc
tactcctacgtcgacggcaagcgcgtcggcctgtgggaggggctggccgagacgttcaac
tccggcagctcggatatcccgctgcaggacatgatcgaccgcatgctgttcgccgaggcc
ctcgagacccagaagtgcctcgacgagggcgtgctgacctcgaccgccgacgcgaacatc
ggctccatcatgggcatcggcttcccgccgtacaccggtggtagcgcgcagttcatcgtc
ggctaccagggcgagctcggcgtcggcaaggaagccttcgtcgcccgcgccaagcaactg
gccgagcgttacggcgagcgcttcaacccgccggcgtcgctgaccaagtag

KEGG   Mycolicibacterium chitae: MCHIJ_22830
Entry
MCHIJ_22830       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_22830
   00650 Butanoate metabolism
    MCHIJ_22830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_22830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_22830
   00310 Lysine degradation
    MCHIJ_22830
   00360 Phenylalanine metabolism
    MCHIJ_22830
   00380 Tryptophan metabolism
    MCHIJ_22830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_22830
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_22830
   00281 Geraniol degradation
    MCHIJ_22830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_22830
   00627 Aminobenzoate degradation
    MCHIJ_22830
   00930 Caprolactam degradation
    MCHIJ_22830
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_22830
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02846
Position
2376646..2377380
AA seq 244 aa
MIGITRNGNVMTLEMQREERRNALNCELVDALREAVEHAAEQDIRAIVLTGAGPVFSSGA
DLTDAAGMAEKLPDKALALNLAIDKAPVPVIGAINGPTIGAGVILSLICDLRVVAPEAYF
QFPIAKYGLAIDNWSVRRLTSLVGAGRARGMLLAAEKLTADTALHTGLANRIGTLADAQA
WAAEIAGYAPLSLQHSKRVLNDDGAYEQPWPEHKEMFDRAWASKDVIEAQVARIEKRPPN
FIGA
NT seq 735 nt   +upstreamnt  +downstreamnt
atgatcggaatcacccgcaacggcaacgtcatgaccctcgagatgcaacgggaggagcgg
cgcaacgctctgaactgtgaactcgtcgacgccctccgcgaggccgtcgaacacgccgcc
gagcaggacatccgcgccatcgtgttgaccggtgcgggcccggtgttcagttccggtgcc
gatctcaccgacgccgccgggatggcggagaaactcccggacaaggcgctggccctgaac
ctggcgatcgacaaggccccggtcccggtgatcggcgccatcaacggtccgaccatcggc
gccggggtgatcctgtcgctgatctgcgatctgcgggtggtggcgccggaggcgtacttc
cagttcccgatcgccaagtacgggctggccatcgacaactggagcgtccgccgactcacc
tcactggtcggggccggccgggcccgcggcatgctgttggccgccgagaaactcaccgcc
gacacagcactgcacaccgggttggccaaccggatcggcacccttgccgacgcgcaggcc
tgggccgccgagatcgccgggtacgcgccgctgtcgctgcagcactccaagcgggtgctc
aacgacgacggtgcctacgagcagccgtggcccgaacacaaggagatgttcgaccgggcc
tgggccagcaaggacgtcatcgaggctcaggtggcgcgcatcgagaagcggccaccgaac
ttcatcggggcgtga

KEGG   Mycolicibacterium chitae: MCHIJ_23590
Entry
MCHIJ_23590       CDS       T06603                                 

Gene name
echA7
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_23590 (echA7)
   00650 Butanoate metabolism
    MCHIJ_23590 (echA7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_23590 (echA7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_23590 (echA7)
   00310 Lysine degradation
    MCHIJ_23590 (echA7)
   00360 Phenylalanine metabolism
    MCHIJ_23590 (echA7)
   00380 Tryptophan metabolism
    MCHIJ_23590 (echA7)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_23590 (echA7)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_23590 (echA7)
   00281 Geraniol degradation
    MCHIJ_23590 (echA7)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_23590 (echA7)
   00627 Aminobenzoate degradation
    MCHIJ_23590 (echA7)
   00930 Caprolactam degradation
    MCHIJ_23590 (echA7)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_23590 (echA7)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ02922
Position
complement(2451523..2452329)
AA seq 268 aa
MDAAQEPRVDYRVEGRAARLTLNSPHNRNALSTELVSGLHEGLRAAVADPEVRMVLLGHT
GGTFCAGADLNQASGSSADPEMLAAERGREMTALLRALVECPLPVIGVIDGHVRAGGMGL
VGACDIVVAGPNSTFALTEARIGVAPSIISLTLLPKLTPRAAGRYYLTGETFTAQVAAQI
GLASIAADDVEAEVARLAAALAKGSPQGLAASKRLTTATILAGFDRDAEELTRESARLFV
SAEAREGMLAFLQKRPPNWAETVTEPND
NT seq 807 nt   +upstreamnt  +downstreamnt
atggacgcagcccaggagccgagggtcgactaccgcgtcgaggggcgggccgcccgactg
acgctgaactcgccgcacaaccgcaacgccctgtcgaccgaactggtcagcggcctgcac
gaggggctccgcgccgcggttgccgatcccgaggtccggatggtgctgctcgggcacacc
ggcggcacgttctgcgcgggcgccgatctcaaccaggcctcgggtagttccgccgatccc
gagatgctggccgccgaacgcggccgcgagatgacggcgctgctgcgagccctggtggag
tgcccgctgccggtgatcggggtgatcgacgggcatgtccgcgccggcggcatggggctg
gtgggcgcctgcgacatcgtggtcgccggaccgaacagcaccttcgcgctgaccgaggcg
cgcatcggcgtcgcgccctcgatcatctcgctgaccctgctgccgaagctgaccccgcgt
gctgcaggtcgctattacctgaccggagagaccttcaccgcccaggtggccgcgcagatc
gggctggcgagcatcgccgccgacgacgtcgaggccgaggtggcgaggctggccgcggcg
ctcgcgaagggatcgccgcagggcctcgcggcatcgaagcgcctgaccacggccacaatc
ctggcggggttcgaccgcgacgccgaggagttgacccgggagtcggcgcggttgttcgtc
tcggcggaggcccgggaggggatgctcgcgttcctacagaagcggccaccgaattgggcc
gaaacggtcacggaacctaacgattag

KEGG   Mycolicibacterium chitae: MCHIJ_25060
Entry
MCHIJ_25060       CDS       T06603                                 

Gene name
echA8
Definition
(GenBank) putative enoyl-CoA hydratase echA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_25060 (echA8)
   00650 Butanoate metabolism
    MCHIJ_25060 (echA8)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_25060 (echA8)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_25060 (echA8)
   00310 Lysine degradation
    MCHIJ_25060 (echA8)
   00360 Phenylalanine metabolism
    MCHIJ_25060 (echA8)
   00380 Tryptophan metabolism
    MCHIJ_25060 (echA8)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_25060 (echA8)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_25060 (echA8)
   00281 Geraniol degradation
    MCHIJ_25060 (echA8)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_25060 (echA8)
   00627 Aminobenzoate degradation
    MCHIJ_25060 (echA8)
   00930 Caprolactam degradation
    MCHIJ_25060 (echA8)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_25060 (echA8)
SSDB
Motif
Pfam: ECH_1 ECH_2 Titin_Z CobA_CobO_BtuR GlcNAc-1_reg Pox_RNA_Pol_22
Other DBs
NCBI-ProteinID: BBZ03069
Position
complement(2593927..2594703)
AA seq 258 aa
MSQYETIIVEREDRVALITLNRPKALNALNSQVMNEVTAAAKELDNDAGVGAIVITGSEK
AFAAGADIKEMADLSFADVFGSDFFAKWGEFAGVRTPTIAAVAGYALGGGCELAMMCDIL
IAADSAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRNMDAEEAERAGLVSRV
VPAADLLSEAKSVAATISQMSLSAARMAKEAVNRSFETTLTEGLLYERRIFHSAFATEDQ
TEGMAAFSEKRAANFKHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgagccagtacgagaccatcatcgtcgagcgcgaggaccgcgtcgccctgatcacgctc
aaccgcccgaaggcgctcaacgcgctgaacagccaggtgatgaacgaagtcaccgcggcg
gcaaaggaattggacaacgacgcgggtgtcggggcgattgtcatcaccggtagcgagaag
gccttcgcggcgggcgcggacatcaaggagatggccgacctgagcttcgccgacgtgttc
ggctccgacttcttcgccaagtggggcgagttcgccggcgtgcgcacccccaccatcgcc
gcggtagcgggctacgcgctcggcggcggctgcgagctggccatgatgtgcgacatcctg
atcgccgccgacagcgccaagttcggtcagccggagatcaagctcggcgtgctgcccggc
atgggcggcagccagcgcctgacccgcgccatcggcaaggccaaggcgatggacctgatc
ctgaccggccgcaacatggatgccgaggaggccgaacgcgccgggctggtgtctcgcgtc
gtgcccgcggccgatctgctgtcggaggcgaagtcggtggcggccaccatctcccagatg
tcgctgtcggcggcgcggatggccaaggaggccgtcaaccgctcgttcgagaccaccctg
accgagggcctgctctacgagcgccgcatcttccactccgcgttcgccaccgaggatcag
accgagggcatggccgcattcagcgagaagcgggctgcgaacttcaaacatcgctaa

KEGG   Mycolicibacterium chitae: MCHIJ_25070
Entry
MCHIJ_25070       CDS       T06603                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_25070
   00650 Butanoate metabolism
    MCHIJ_25070
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_25070
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_25070
   00310 Lysine degradation
    MCHIJ_25070
   00360 Phenylalanine metabolism
    MCHIJ_25070
   00380 Tryptophan metabolism
    MCHIJ_25070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_25070
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_25070
   00281 Geraniol degradation
    MCHIJ_25070
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_25070
   00627 Aminobenzoate degradation
    MCHIJ_25070
   00930 Caprolactam degradation
    MCHIJ_25070
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_25070
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: BBZ03070
Position
complement(2594717..2595745)
AA seq 342 aa
MTDEILTRVENGVGILTLNRPKAINSLTQTMVDVLNEKLTAWASDDAIRAVLVDGAGERG
LCAGGDVVALYHSARADGSAARKFWFDEYQMNALIGEYPKPYIALMDGIVMGGGVGVAGH
GDVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRSPGALGLYAALTGSPFSGADAIALGFA
DHFVPHDKLAELTADIIAGDVDAALAKHATTPPDSELLAQQSWIDECFAADTVADIVANL
RGHDAGPANAAADVIAGRSPVALSVTLESVRRTKKLDTLRDALVQEYRVSCASARSHDFV
EGIRAQLVDKDRNPKWSPASLAEVTGDDVESYFAPADPDLTF
NT seq 1029 nt   +upstreamnt  +downstreamnt
gtgaccgacgagatcctcacccgcgtcgagaacggcgtcgggatcctgacgctgaaccga
cccaaggccatcaactcgttgacccagaccatggtcgacgtgctcaacgagaagctcacc
gcgtgggcctccgacgacgccatccgcgccgtgctggtcgacggtgccggcgagcgcggc
ctgtgcgccggcggtgacgtggtggcgctctatcacagcgcccgcgccgacggcagcgcc
gcccgcaagttctggttcgacgagtaccagatgaacgcgctgatcggcgagtatcccaag
ccctacatcgccctgatggacggcatcgtcatgggcggcggcgtgggtgtcgccgggcac
ggcgacgtccgcgtggtcaccgacaccaccaagatggccatgcccgaggtgggcatcggc
ttcatccccgatgtcggcggcacctatctgctgtcccgctcgcccggcgcgctgggcctg
tacgcggcgctgaccgggtccccgttctccggggccgacgcgatcgcgctcggcttcgcc
gatcacttcgtcccgcacgacaagctcgccgaactgaccgccgacatcatcgccggggac
gtcgacgccgcgctggccaagcacgccacgacgccgccggacagtgaactcctcgcccag
cagtcgtggatcgacgagtgtttcgcggccgacaccgtcgccgacatcgtcgccaacctg
cgcggccacgacgccggcccggccaacgccgcggccgacgtcatcgccggccgctccccg
gtagcgctgtcggtcaccctggaatccgtgcgccgcaccaagaagctggacaccctgcgc
gacgcgctggtccaggagtaccgcgtctcgtgcgcctcggcgcgctcgcacgacttcgtc
gagggcatccgcgcgcagctcgtcgacaaggaccgcaacccgaagtggtcgccggcctcg
ctggccgaggtcactggcgacgacgtcgaaagctacttcgccccagccgatcccgacctg
accttctag

KEGG   Mycolicibacterium chitae: MCHIJ_25910
Entry
MCHIJ_25910       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_25910
   00650 Butanoate metabolism
    MCHIJ_25910
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_25910
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_25910
   00310 Lysine degradation
    MCHIJ_25910
   00360 Phenylalanine metabolism
    MCHIJ_25910
   00380 Tryptophan metabolism
    MCHIJ_25910
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_25910
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_25910
   00281 Geraniol degradation
    MCHIJ_25910
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_25910
   00627 Aminobenzoate degradation
    MCHIJ_25910
   00930 Caprolactam degradation
    MCHIJ_25910
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_25910
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ03154
Position
complement(2675474..2676295)
AA seq 273 aa
MSGMTITDSGLDALAPVDGLLVDLTDGVLAITIDRPDSLNSVNPQVFAAMADTLERAATD
PRVRVVRIGGTGRGFCSGAAIGAEDTGDGHEPMETLHEGNRAIRAIVNMPRPVVAVVQGP
TAGIGVSVALACDLVLASEKAFFLLAFTKIGLMPDGGASALVAAAIGRIRAMKMALLAER
VSAADALDWGMVSAVYPADTLEAESTKLIQRLMSGPAVAYAKTKKAINGATLDTLDTTLA
HETAGQHKLLQAPDLAEGIQAFQEKRSPNFTDV
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgtctggcatgacgatcactgactccggcctggacgcgctcgcaccggtcgacggcctg
cttgtcgacctgaccgacggcgtgctggcgatcaccatcgaccgtccggacagcctcaac
tcggtgaacccgcaggtattcgcggccatggccgacacgctggagcgcgccgccaccgat
ccccgcgtgcgcgtggtccgcatcggcggcaccggacgcggcttctgctccggggcggcg
atcggcgccgaggacaccggtgacggtcacgagccgatggaaaccctgcacgagggcaac
cgcgccatccgcgcgatcgtcaacatgccccggccggtggtggccgtggtgcagggcccg
actgcgggcatcggggtgtcggtggccctggcctgcgacctcgtgctggcttcggagaag
gccttcttcctgttggcgttcaccaagatcggcctgatgcccgatggcggcgcctccgca
ctggtggccgccgctatcggccgcatccgggcgatgaagatggccctgctggccgagcgg
gtgtccgcggccgacgccctggactggggcatggtcagcgcggtgtatcccgccgacacg
ctcgaggccgagtccaccaagctgatccagcgcctgatgtcgggtcccgcggtggcctac
gccaagaccaagaaggccatcaacggcgccacgctggacaccctggacaccacgctggcc
cacgagaccgccggccagcacaagctgctgcaggcccccgacctcgccgagggcatccag
gccttccaggagaagcgcagccccaacttcaccgacgtctga

KEGG   Mycolicibacterium chitae: MCHIJ_28560
Entry
MCHIJ_28560       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_28560
   00650 Butanoate metabolism
    MCHIJ_28560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_28560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_28560
   00310 Lysine degradation
    MCHIJ_28560
   00360 Phenylalanine metabolism
    MCHIJ_28560
   00380 Tryptophan metabolism
    MCHIJ_28560
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_28560
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_28560
   00281 Geraniol degradation
    MCHIJ_28560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_28560
   00627 Aminobenzoate degradation
    MCHIJ_28560
   00930 Caprolactam degradation
    MCHIJ_28560
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_28560
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ03419
Position
2951836..2952597
AA seq 253 aa
MYGMPAEIDVQADGPLRIITLNRPDALNAVNDALHVGLAHLWEALNEDAEARVAVLTGAG
RAFSAGGDFNYLDELRNDEALRTKTIKHGRDLVIGMIRCRIPVIAAVNGPAVGLGCSLAG
MSDIVYMAETAHFADPHVQIGLVAADGGPLVWPSQISFLQAKEFALTATKITAQRALELG
MANHVVADPLSEAIACAKKILELPQQAVEATKRLMNIQLERSVMASLDYANLSEYVSFGT
ADFNRIVDGLIKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtatggaatgccagcagaaatcgacgtccaggccgacggcccgctgcggatcatcacg
ctgaaccggcccgatgccctcaacgccgtcaacgacgcgttgcacgtcggactggcgcac
ctgtgggaggcgctcaacgaggacgccgaggcgcgcgtggcggtgctcaccggggccggc
cgggccttctcggccggcggtgacttcaactacctcgacgagctgcgcaacgatgaggcg
ttgcgcaccaagaccatcaagcacggccgcgacctggtgatcggcatgatccgctgccgc
atccccgtcatcgccgcggtcaacgggcccgccgtcggcctgggctgcagcctggccggc
atgtcggacatcgtctacatggccgagaccgcgcacttcgcggacccgcacgtgcagatc
ggtctggtggccgccgacggcggtccgctggtgtggcccagccagatcagcttcctgcag
gccaaggagttcgccttgaccgcaacgaagatcaccgcacagcgggccctcgagctgggc
atggccaaccacgtggtggccgacccgctcagcgaggccatcgcctgcgccaagaagatc
ctggagttgccgcagcaggccgtcgaggccaccaagcggctgatgaacatccagctcgag
cgttcggtgatggcgtcgctggactacgccaacctcagcgagtacgtgtcgttcgggacc
gcggacttcaaccgcatcgtcgacggcctcatcaagaagtag

KEGG   Mycolicibacterium chitae: MCHIJ_30330
Entry
MCHIJ_30330       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_30330
   00650 Butanoate metabolism
    MCHIJ_30330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_30330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_30330
   00310 Lysine degradation
    MCHIJ_30330
   00360 Phenylalanine metabolism
    MCHIJ_30330
   00380 Tryptophan metabolism
    MCHIJ_30330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_30330
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_30330
   00281 Geraniol degradation
    MCHIJ_30330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_30330
   00627 Aminobenzoate degradation
    MCHIJ_30330
   00930 Caprolactam degradation
    MCHIJ_30330
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_30330
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ03596
Position
complement(3139604..3140359)
AA seq 251 aa
MSSDLVLYSVADRVALLTVNDPDRRNAVTDAMSAQLRAAVERAEADENVHALVITGAGKA
FCAGADLSALGAAAEEGLLRIYDGFMAIANCALPTVAAVNGAAVGAGLNLALAADVRIAG
PHALFDPRFQKLGIHPGGGATWMLQRGVGPQVARAALLFGMRFDAEAAVTHGLALQTADD
PVAAALELAAGPANSPREVVLATKATMRATAAPGSVDTEAHHTAMRTELGPQAKSIQSPE
FQSRLQAAQRK
NT seq 756 nt   +upstreamnt  +downstreamnt
atgagttctgacctcgtgctctattccgtggccgaccgcgtcgccctgctcaccgtcaac
gacccggaccggcgcaacgccgtcaccgacgccatgtcggcgcagttgcgcgccgccgtc
gagcgcgccgaggccgacgagaatgtgcacgcgctggtcatcaccggcgccggcaaggcg
ttctgcgcgggcgccgacctgagcgcgctgggcgcggcggccgaggaggggctgctgcgc
atctacgacgggttcatggccatcgccaactgcgctctgcccacggtcgcggcggtcaac
ggcgccgcggtcggggccgggctgaacctggcgctggccgccgacgtgcgcatcgctggc
ccgcacgccctgttcgacccgcggttccagaagctgggcatccatcccggcgggggcgcc
acctggatgctgcagcgcggcgtgggcccgcaggtcgcgcgcgcggcgctgctgttcggg
atgcgcttcgacgccgaggccgccgtcacccacggattggcgctgcagaccgccgacgat
ccggtggccgccgcgctcgagctggccgccggtccggcgaactccccgcgcgaggtggtg
ttggccaccaaggccaccatgcgggcgacggccgcccccggctcggtcgacaccgaagcc
caccacaccgcgatgcgcaccgagcttggcccacaggcgaagtcgatccagtccccggag
ttccagtcccggctgcaggccgcgcagcgcaagtag

KEGG   Mycolicibacterium chitae: MCHIJ_36510
Entry
MCHIJ_36510       CDS       T06603                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01200  Carbon metabolism
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_36510
   00650 Butanoate metabolism
    MCHIJ_36510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_36510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_36510
   00310 Lysine degradation
    MCHIJ_36510
   00380 Tryptophan metabolism
    MCHIJ_36510
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_36510
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_36510
   00281 Geraniol degradation
    MCHIJ_36510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_36510
   00930 Caprolactam degradation
    MCHIJ_36510
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCHIJ_36510
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_36510
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCHIJ_36510
SSDB
Motif
Pfam: ECH_1 3HCDH_N 3HCDH ECH_2 UPF0016
Other DBs
NCBI-ProteinID: BBZ04214
Position
3842612..3844630
AA seq 672 aa
MFTWNRDDAGVVVVTIDDPSQAVNTANENFRRQFPELLDQLEKDRDSITGVILTSAKRTF
FAGADLASFATAGPEDVPAVHALLDDLKAGFRRLETLGVPVVAAINGAALGGGCELSLAC
HYRVAVDRPDVLIGLPEVSLGLLPGAGGIVRTVRMFGLAKALELILIPGTRFSPGGALEV
GLVDELVGSDDDLVPAARRWLAAGPLSRKPWDERGYRIPGGSARDPETASMLALLPAKAR
KKTRGAPSDAVQAIVSTAVESTLVDFGNAQRIESRYCAQLVGGQVSSNIIKGTFFDVRSA
RARSRALTDGSGLQHRRVLILGDNPMGRGIEKLCQDAGLDTVVVDGVDDAITGHFDVLIE
TMFSDLASRTKVLSQVSELVGAGTAVATNSSWTALADLADHVADPSDLVGFHLFAPVDRM
ELAEIAIADTTNDHAKSVVVDLARAMNKTSIVVGGAAGFYANRVLAAFLGEALRLLSDGV
SPAAIEQAAYQAGFPSGVLRLADAIGLPELRELIDAVTDHAADSDDSSPRTVLDTMVGEL
DRTGQVSGRGFYDYPEARRGHLWQGLQDQFAPATLEVGLVEIQERLLFAGALEAAACLDR
KILHSVAEGNVGSILGVGYPIWTGGAVNYIQQYAGGPEGFAERARILAQSWGRRFDPAVL
TAPIGSVVGAQS
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgtttacatggaatcgagacgatgccggcgtcgtagtggtgactatcgacgacccgtcg
caggccgtgaacacagccaacgagaattttcgccgccagtttcccgagcttctcgatcag
ctcgaaaaggaccgggattcgatcaccggtgtcattctgacctcggccaagcggacgttc
ttcgccggagctgacctggcatccttcgcaacggccggacccgaggacgtcccggccgtg
catgccttgctcgacgatctgaaagctggatttcgccgactcgaaacgctgggtgtaccc
gtcgtggccgccatcaacggcgctgctctcggtggtgggtgcgagctcagtctggcctgc
cactaccgggtcgctgtcgatcgcccggacgtgttgatcggattgcccgaagtctctctg
gggctgctgcccggcgcgggtggaatcgtacggacagtgcgcatgttcgggttggccaag
gcactggaactgatcttgatacctggcacacggttcagtccggggggtgcgctggaggtc
ggtcttgtcgacgagttggtcggcagcgacgacgacctggtgccggcggcccggcggtgg
cttgcggccggcccgctctcgcggaaaccctgggatgaacgcggttaccggattcccggt
ggaagcgctcgcgacccggagaccgcgtcgatgttggctctgctgccggcaaaagcccgc
aagaagacccgcggcgccccgtcggatgccgtccaggcgatcgtctccacggcagtggag
agcaccctcgtcgacttcggcaatgcccaaagaatcgagtcccggtactgtgcccaactt
gtcggcggtcaggtgtcgtcgaacatcatcaaagggacattcttcgatgtgcgatcagcg
cgagcgcgctcacgggctctgacggacggctcaggactgcagcaccgacgcgtactcatc
ctcggtgacaatccgatgggacgaggaattgagaagttgtgccaagacgcgggtctcgat
accgttgtggtcgacggtgtcgatgacgcgattaccggtcacttcgatgtcctgatcgaa
acgatgttttctgacctcgcctctcgcaccaaggttttgagccaggtgagtgaacttgtc
ggcgcagggacagcggtcgccacgaactcgtcgtggacggcgctcgccgacctcgccgac
cacgtcgctgacccgtcggatctagttggttttcatctgttcgccccggtcgaccggatg
gagctcgccgaaatcgccatcgccgacaccaccaacgaccatgccaagtccgtggtggtc
gacctcgcccgggcaatgaacaagacgagcattgttgtgggcggcgcggcgggcttctac
gccaaccgggtactggcggccttcctcggtgaggcgttgcgcctactctccgatggagtt
tcgccggccgccatcgagcaggccgcctatcaggccggttttccctcaggtgtccttcgg
cttgccgatgcaattggcctgccggaacttcgcgaactgatcgatgcggtgacagaccac
gctgccgactccgacgattcgtcaccgcgcacagtcctcgacaccatggtgggagaactc
gaccggaccgggcaggtgtccggcaggggattctacgactacccggaggcccgccgaggt
catctgtggcagggtctgcaagaccagttcgcacctgcaaccctcgaggtcggcctcgtc
gaaattcaggaacgcttactgtttgcgggagcactggaggcagcggcgtgcttggaccgc
aagatcctgcactcggtggccgagggcaatgtcggatccatactcggagtcggctatccc
atctggacaggcggcgccgtcaactacatccagcagtacgcaggaggacccgaagggttc
gccgaacgcgcccgaatccttgcgcaatcgtggggacgacggtttgatccggctgtcctg
accgcgccgatcggcagtgtcgtgggagcccaaagctaa

KEGG   Mycolicibacterium chitae: MCHIJ_37010
Entry
MCHIJ_37010       CDS       T06603                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01200  Carbon metabolism
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_37010
   00650 Butanoate metabolism
    MCHIJ_37010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_37010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_37010
   00310 Lysine degradation
    MCHIJ_37010
   00380 Tryptophan metabolism
    MCHIJ_37010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_37010
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_37010
   00281 Geraniol degradation
    MCHIJ_37010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_37010
   00930 Caprolactam degradation
    MCHIJ_37010
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCHIJ_37010
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_37010
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCHIJ_37010
SSDB
Motif
Pfam: ECH_1 ECH_2 3HCDH
Other DBs
NCBI-ProteinID: BBZ04264
Position
3892573..3894129
AA seq 518 aa
MAIDWTQDADGVVVLTMDAPGAGANTITDAFRGALDQALDRIDAERDGITGVVIASAKKT
FLAGMDLDVLVEQVMPSDPADVMALATGLKAQLRRLETLGLPVVAAINGAALGGGLELAL
ACHHRIAADVPGNRMGLPEVQLGVLPGAGGVARTVRLLGIEPALTAVLLSGARLKPVAAQ
EIGLVDDVVGGIDELVPAAKAWIAAHPDAHTQPWDVRGYRIPGGEPSEPAFAQNLPAFPA
NLHKRLGTDRMPAPRAILAAAVEGAQVDFDTAQLIESRYFVSLVKSPVARNMVQAFFFDV
QAVQSAGSQPQDLAGVVGDEFTTRVRAAQLIEAIRMLADGIDPAVIEQAATQAGYAVPPL
QAADELGLATLREIIDETSADGVVGTMLDLGRPGAPGGAGFYDYLDGQRARLWDGLREQW
NTVREPEVPFGDLQDRLLFSQVIAAQQALDDGVVDSDAAANVGSLFALGFPAWTGGVRQF
VAGYPGGEKAFRRRAEALAGRYGERFRLPASLGAVQRA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcgattgactggacccaggacgccgacggcgtcgttgtcctcacgatggacgccccg
ggggcgggcgccaacacgatcaccgacgccttccgtggggcgctcgaccaggccctggac
cgcatcgacgccgaacgcgacggcatcaccggggtggtgatcgcctcggcgaagaagacc
ttcctggccggcatggacctcgacgtgctcgtcgagcaggtgatgccgagcgaccccgcc
gacgtcatggcgctggcgaccggactcaaggcacagctgcgccgcctggagaccctcggc
ctgccggtggtggcggcgatcaacggcgccgcgctcggcgggggcctcgagctcgcgctg
gcctgccaccaccgcatcgccgccgacgtacccggcaaccggatgggcctgcccgaggtg
cagttgggtgtgctccccggcgcgggcggcgtcgcgcgcacggtgcgcctgctcggcatc
gaaccggcgctgacggcggtgctgctgtccggggcccggctgaagccggtcgcggcccag
gagatcggccttgtcgacgacgtcgtcggcggcatcgacgaacttgtcccggccgccaag
gcgtggattgccgcccaccccgatgcgcatacccaaccctgggatgtccggggataccgc
atccccggcggcgaaccgtcggagcccgcgttcgcgcagaacctccccgcgttcccggcg
aacctgcacaagcggctcgggaccgaccgcatgccggcgccgcgtgcgatcctggccgcg
gccgtggagggcgcccaggtcgacttcgacaccgcccagctcatcgaatcgcggtacttc
gtctcgctggtcaagagcccggtggcccgaaacatggtgcaggcgttcttcttcgacgtg
caggccgtgcagagcgcaggctcacaaccgcaagacctcgccggcgtcgtcggcgacgag
ttcaccacgcgggtgcgcgccgcgcagctgatcgaggcgatccgcatgctggccgacggg
atcgatccggccgtcatcgaacaggccgcgacccaggccggttacgcggtgcccccgctg
caggccgccgacgaacttggcctggcgaccctgcgcgagatcatcgatgagacctcggcc
gacggggttgtgggcacgatgctcgaccttggccggcccggcgcgccgggcggggccggc
ttctacgactacctcgacggccaacgggcccggctttgggacggtctgcgggagcagtgg
aacacggtgcgcgagccggaggtaccgttcggcgatctgcaggaccggctgctgttcagc
caggtcatcgcggcgcagcaggcgctcgacgacggggtcgtcgactccgatgcggcggcc
aacgtcgggtcgctgttcgcgctgggcttcccggcatggaccgggggagtccggcagttc
gtcgccggttacccgggtggcgagaaggccttccggcgccgcgccgaggccctggccggc
cgctacggcgagcgcttccggttgcccgcatccctgggggcggtgcagcgcgcctga

KEGG   Mycolicibacterium chitae: MCHIJ_41140
Entry
MCHIJ_41140       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_41140
   00650 Butanoate metabolism
    MCHIJ_41140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_41140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_41140
   00310 Lysine degradation
    MCHIJ_41140
   00360 Phenylalanine metabolism
    MCHIJ_41140
   00380 Tryptophan metabolism
    MCHIJ_41140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_41140
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_41140
   00281 Geraniol degradation
    MCHIJ_41140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_41140
   00627 Aminobenzoate degradation
    MCHIJ_41140
   00930 Caprolactam degradation
    MCHIJ_41140
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_41140
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ04677
Position
complement(4317559..4318386)
AA seq 275 aa
MSADFVSEFVLVDRPRPGVAVITLNRPERMNSMAFDVMVPLRRVLDDVKHDNDVRAVILT
GAGSGFSSGADHKSAGAVPHVEGLTRPAFGLRSMQLLDDVILGLRRLHQPVIAAVNGAAI
GGGLCLALACDIRVAGAAAYFRAAGINNGLTASELGLSFLLPRAIGTSRAFEIMLTGRDV
DAVEAERIGLVSQQVPDADLLPTCLAMAQRIASFSRPGIELTKRTLWSGLDAATLEGHMQ
AEGLGQLYLRLLTGNFEEAVAARAENRDPVFTDDK
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgagtgctgacttcgtctcggaattcgtcctcgtcgaccgcccgcgccccggggtcgcg
gtgatcacactgaaccggcccgagcggatgaactcgatggccttcgacgtgatggtccca
ctgcgtcgggtcctcgacgacgtcaagcatgacaatgacgtccgcgcggtgatcctcacg
ggtgcgggcagcggcttctcctccggtgccgaccacaagtccgccggcgccgtaccgcat
gtcgagggcctgacccggcccgccttcggcctgcgctcgatgcagctgctcgacgacgtc
atcctgggactgcgccggctgcaccagccggtgatcgcggcggtcaacggcgccgccatc
ggcggcggcctgtgcctggcgctggcctgcgacatccgggtggccggcgcagcggcgtat
ttccgcgcggccgggatcaacaacgggctgaccgccagcgagctggggctgagcttcctg
ctgccgcgcgccatcggcacgtcgcgggccttcgagatcatgctcaccggccgcgatgtc
gacgccgtggaggccgagcggatcggcttggtgtcccagcaggtccccgacgccgacctg
ctgccgacctgtctggcgatggcgcagcgcatcgcgtcgttctcgcggccgggaatcgag
ttgacgaagcgcacgctatggagtggactggacgccgctaccctggaagggcacatgcag
gccgaagggctggggcagctctatctgcgcctactcaccggaaatttcgaagaagcggtg
gccgcgcgcgcggagaacagagaccccgtcttcaccgacgacaagtag

KEGG   Mycolicibacterium chitae: MCHIJ_42380
Entry
MCHIJ_42380       CDS       T06603                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_42380
   00650 Butanoate metabolism
    MCHIJ_42380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_42380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_42380
   00310 Lysine degradation
    MCHIJ_42380
   00360 Phenylalanine metabolism
    MCHIJ_42380
   00380 Tryptophan metabolism
    MCHIJ_42380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_42380
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_42380
   00281 Geraniol degradation
    MCHIJ_42380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_42380
   00627 Aminobenzoate degradation
    MCHIJ_42380
   00930 Caprolactam degradation
    MCHIJ_42380
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_42380
SSDB
Motif
Pfam: SGL ECH_1 ECH_2 NHL Str_synth Reg_prop DHFR_2
Other DBs
NCBI-ProteinID: BBZ04801
Position
4450768..4452564
AA seq 598 aa
MSAASPTPQIRYEQPSAGVARIVLARPDKRNAQDRAMLHELDDAYRRAVGDESVRVIILA
ADGPDFSAGHDLRVDTAYDMTGVTPRTLTGGFTAPGAEGWYATEAELFLGLCLRWRDIPR
PTIAAVHGRVIGGGLELIWPCDLIVAADDTVFHDPISAFGCAVAEYFVHPWELGHRRAKE
MLFTGEPIDAFDAEALGMVNRVVPRADLESETLALAERIAARPSFGIRLAKRAVNNALDL
QGQRAAVEWAFDAHHLAHSHNRELYDNLVDPAGADLIRAEARSGHTRPRPSYLTRSESSK
EDAVERQFTTVVEGGDYFEGARWRDGRWYVSDALKGVVCAFDEAGRREDLMQVDALCSGL
GWLPDGTLLVVSMKDRTLLARGADGAVRRHADLSALTPHWINDMYVDTRGRAWVGTIGFA
IHEGETPRPGELFRVDPDGTVVVAARDLWCPNGVVVTADGTTLIVAESFAARLTAFTIGA
DGTLSDRRVFAQFGPAPDLAGPAEMIAATELAPDGMTIDSQDHVWVADANHQRCVRVSPA
GEIVDEVAHPGGVNVYTCALGGSDGRQLLLAAADGFFEAIQGVGGTAALLATPVDVPA
NT seq 1797 nt   +upstreamnt  +downstreamnt
gtgagcgccgcatcccccaccccccagattcggtacgagcagcccagcgcgggggtggcg
cgcatcgtgctggcccgcccggacaagcgcaacgcgcaagaccgcgcgatgttgcacgaa
ctcgacgacgcctaccggcgggccgtcggggacgaatccgtccgcgtcatcatcctggcc
gcggacgggcccgacttctcggccggtcacgacctgcgggtcgacaccgcctacgacatg
accggtgtcaccccgcgcaccctcaccggcggcttcaccgcgcccggagccgagggctgg
tacgccaccgaggccgaactcttcctgggactgtgcctgcgctggcgggacatcccccgg
cccaccatcgcggccgtgcacggtcgggtcatcggcggcggcctggagttgatctggccg
tgcgacctgatcgtcgccgccgacgacaccgtgttccacgacccgatcagcgcgttcggc
tgcgcggtcgccgagtacttcgtgcacccttgggaactggggcatcgccgagccaaggag
atgctgttcaccggcgagcccatcgatgccttcgatgccgaggccctcggcatggtcaac
cgtgtcgtgccccgggcggatctggaatccgaaacactggcgctggccgagcggatcgcg
gcgcgcccgagtttcggcatccggctggccaaacgcgcggtcaacaacgccttggatctg
caaggtcagcgggcggcggtggagtgggccttcgacgcccaccacttggcgcactcacac
aaccgcgagctctacgacaacctcgtcgatcccgccggcgccgatctgatccgcgccgag
gcgcgcagcggccacacccgtccccgtcccagctacctgaccagatccgaatccagcaag
gaggatgccgtggaacgccagttcaccaccgtcgtcgagggcggcgactacttcgagggg
gcgcgctggcgcgacgggcggtggtatgtctccgacgccctcaagggcgtggtgtgcgcg
ttcgacgaagccggccggcgcgaggatctgatgcaggtcgacgccctgtgctccggactc
ggttggctgcccgacggcacgttgctggtggtgtccatgaaggaccggacgctgttggcg
cgcggcgccgacggagcggtgcgccgccacgccgacctgtccgccctcacaccgcactgg
atcaacgacatgtacgtcgacacgcgggggcgggcctgggtgggcaccatcggattcgcc
atccacgagggtgaaactccgcgccccggtgagcttttccgggtcgacccggacgggacg
gtggtcgtcgccgcccgcgacctgtggtgccccaacggtgtggtggtgaccgccgacggc
accaccctcatcgtcgccgaatcgttcgccgcccggttgaccgcattcaccatcggggcc
gacggcacgctgagcgaccggcgggtcttcgcccagttcggccccgcgccggacctcgcc
ggaccggccgagatgatcgcggccaccgaactggcgccggacgggatgaccatcgactcg
caggaccacgtctgggttgccgacgcgaaccaccaacgctgcgtgcgggtctcccccgcc
ggcgagattgtcgacgaggtggcccatcccggcggggtcaacgtgtacacgtgcgcgctg
ggcgggtcggacggtcggcaactgctgctggcggcggccgacggattcttcgaagcgatc
cagggcgtgggcggcaccgccgccctgctggcgacacccgtcgacgttcccgcctga

KEGG   Mycolicibacterium chitae: MCHIJ_44620
Entry
MCHIJ_44620       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_44620
   00650 Butanoate metabolism
    MCHIJ_44620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_44620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_44620
   00310 Lysine degradation
    MCHIJ_44620
   00360 Phenylalanine metabolism
    MCHIJ_44620
   00380 Tryptophan metabolism
    MCHIJ_44620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_44620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_44620
   00281 Geraniol degradation
    MCHIJ_44620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_44620
   00627 Aminobenzoate degradation
    MCHIJ_44620
   00930 Caprolactam degradation
    MCHIJ_44620
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_44620
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ05025
Position
4664168..4664932
AA seq 254 aa
MAMSDSDVLLIDTTDRVRTLTLNRPKSRNALSKALRTELFSALAAAQSDDDVDVVILTAA
DPVFCAGLDLKELGDTTELPDISPKWPDMDKPVIGAINGAAVTGGLEIALYCDVLIASEK
AAFADTHARVGLLPTWGLSVRLPQKVGVGLARRMSLTGDYLSAEDALRAGLVTEVVPHDG
LLDAARAVAASIVGNNQKAVRALLDSYHRIDAAQTSGALWLEAEAARAWMRSTSGDDVAA
SRASVMDRGRSQVR
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccatgagtgactccgacgtcctgttgatcgacaccaccgaccgggtccggaccctg
acgctgaaccggccgaagtcccgcaacgcgctgtcgaaggcgctgcgcaccgagttgttc
agcgccctggcggccgcccagtccgacgacgacgtcgatgtggtgatcctgaccgccgcc
gacccggtgttctgcgcgggcctggacctcaaggaactcggcgacaccaccgagctgccc
gacatctccccgaagtggccggacatggacaagccggtgatcggggcgatcaacggcgcc
gcggtcaccggtggcctggagatcgcgctgtactgcgacgtgctgatcgcctcggagaag
gccgcgttcgccgacacccacgcccgggtggggctgctgcccacctgggggctgtcggtg
cggctgccgcagaaggtcggcgtcgggctggcccggcggatgagcctgaccggcgactac
ctgtcggccgaggacgcgctgcgcgccgggctggtcaccgaggtggtgccgcacgacggg
ctgctggacgcggcgcgggccgtggccgcctcgatcgtgggcaacaaccagaaggcggtg
cgggcgctgctggactcgtatcaccgcatcgacgccgcgcagaccagtggcgcgctgtgg
ctcgaggccgaggccgcacgcgcctggatgcggtcgaccagcggtgacgacgtcgccgcc
agccgcgcgtcggtgatggaccgcggccgcagccaggtccgctag

KEGG   Mycolicibacterium chitae: MCHIJ_46410
Entry
MCHIJ_46410       CDS       T06603                                 

Gene name
echA17
Definition
(GenBank) putative enoyl-CoA hydratase echA17
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_46410 (echA17)
   00650 Butanoate metabolism
    MCHIJ_46410 (echA17)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_46410 (echA17)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_46410 (echA17)
   00310 Lysine degradation
    MCHIJ_46410 (echA17)
   00360 Phenylalanine metabolism
    MCHIJ_46410 (echA17)
   00380 Tryptophan metabolism
    MCHIJ_46410 (echA17)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_46410 (echA17)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_46410 (echA17)
   00281 Geraniol degradation
    MCHIJ_46410 (echA17)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_46410 (echA17)
   00627 Aminobenzoate degradation
    MCHIJ_46410 (echA17)
   00930 Caprolactam degradation
    MCHIJ_46410 (echA17)
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_46410 (echA17)
SSDB
Motif
Pfam: ECH_1 ECH_2 Glyco_hydro_3_C
Other DBs
NCBI-ProteinID: BBZ05204
Position
complement(4847250..4847972)
AA seq 240 aa
MTIQREFVSLHTDPQQPGIGTIWLSRPPTNALTRQMYRELTATAADAAARDDIAVVILFG
GHEIFSAGDDVPELRTLTREQADRAATVRDTAIEAVAALPKPTVAAVTGYALGAGLWLAL
AADWRVAGDNVKVAASEILADLIPGGAALDRLTAAVGPGRAKDMVFSGRFVDAEEAATVG
LLDQLVAPDAVYDAACARARRYLTAPGVAVAAAKDIIDGRCDGAEQRRRYLDVFAAGSNV
NT seq 723 nt   +upstreamnt  +downstreamnt
gtgaccatccagcgcgagttcgtcagcctgcacaccgatccccagcaaccgggcatcggc
accatctggctgtcccggccgcccaccaacgccctgacccggcagatgtaccgggagctg
accgccaccgccgccgacgccgccgcgcgcgacgacattgcggtggtgatcctgttcggc
gggcacgagatcttctccgccggcgacgacgtgccggaactgcgcaccctgacccgcgag
caggccgaccgggcggccaccgtccgggacaccgcgatcgaggccgtcgcggcccttccc
aaacccaccgtcgccgccgtcaccgggtacgcgctgggcgcgggactgtggctggcgctg
gccgcggactggcgggtggccggggacaacgtcaaggtcgccgcctcggagatcctcgcg
gatctgatccccggcggcgccgccctggaccggctgaccgcggccgtgggccccggccgc
gccaaggacatggtgttcagcgggcggttcgtcgacgccgaggaggccgccaccgtcggt
ctgctggaccagctggtggcccccgacgcggtgtacgacgcggcgtgcgcccgggcccgg
cgctacctgacggcgccgggcgtggccgtggccgccgccaaggacatcatcgacggccgc
tgcgacggcgctgagcagcgccgccgctacctcgacgtgttcgccgcgggcagcaacgtt
tag

KEGG   Mycolicibacterium chitae: MCHIJ_48390
Entry
MCHIJ_48390       CDS       T06603                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00281  Geraniol degradation
mcht00310  Lysine degradation
mcht00360  Phenylalanine metabolism
mcht00362  Benzoate degradation
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00627  Aminobenzoate degradation
mcht00640  Propanoate metabolism
mcht00650  Butanoate metabolism
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01212  Fatty acid metabolism
Module
mcht_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MCHIJ_48390
   00650 Butanoate metabolism
    MCHIJ_48390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_48390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_48390
   00310 Lysine degradation
    MCHIJ_48390
   00360 Phenylalanine metabolism
    MCHIJ_48390
   00380 Tryptophan metabolism
    MCHIJ_48390
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_48390
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_48390
   00281 Geraniol degradation
    MCHIJ_48390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCHIJ_48390
   00627 Aminobenzoate degradation
    MCHIJ_48390
   00930 Caprolactam degradation
    MCHIJ_48390
Enzymes [BR:mcht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCHIJ_48390
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BBZ05402
Position
5042764..5043528
AA seq 254 aa
MTVVHTTDHGAVRVVTMNRPEARNALGRELIEALFAALSDAEADPAVRVAVLTGTDPAFC
AGVDLKEAQQHGREYFARFQSHHCITKPAEMAIPVIGAVNGPVFTGGLEMALACDFLIAS
ERAVFADTHARVGILPGGGMTARLPQRVGAGMARRLSMTGEVVDAARAERIGLVTEVVAH
ERLLPRALELAAQVAEVDAPTMAGLKEIYQRGWAGVTEPALAAEKRISGTQELDAAGLAQ
RRAEVTARNKSQIL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgactgtcgtgcacaccaccgaccacggcgcggtccgcgtggtcaccatgaaccggccc
gaggcgcgaaacgcgttggggcgcgagctgatcgaggcgcttttcgccgccctgagcgac
gcggaggccgatccggcggtgcgggtggcggtcctgaccgggaccgacccggcgttctgc
gccggcgtcgacctcaaggaggcccagcagcacggccgggagtacttcgcccggttccag
agccaccactgcatcaccaaacccgccgagatggctatcccggtgatcggcgccgtcaac
ggtccggtgttcaccggcggcctcgagatggcgttggcctgtgacttcctgatcgcctcg
gagcgcgcggttttcgccgacacgcacgcccgggtgggcatcctgcccggcggcggcatg
acggcccggctgccgcagcgggtcggtgccggcatggcgcggcggctgtcgatgaccggt
gaggtggtcgacgccgcgcgcgccgaacgcatcggtctggtcaccgaggtggtggcccac
gagcggctcctaccccgcgccctcgagctggccgcccaggtcgccgaggtggacgcgccg
accatggccggcctcaaggagatctatcagcgcggctgggccggggtcaccgaacccgcg
ctggccgccgagaagcggatctccggcacccaggaactcgacgccgcgggtctggcgcaa
cgcagggccgaggtgacggcccggaacaagagccagatactgtaa

DBGET integrated database retrieval system