KEGG   Mycolicibacterium chitae: MCHIJ_01850
Entry
MCHIJ_01850       CDS       T06603                                 

Definition
(GenBank) lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_01850
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MCHIJ_01850
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     MCHIJ_01850
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180
Other DBs
NCBI-ProteinID: BBZ00748
Position
complement(170799..171719)
AA seq 306 aa
MSALPSDDDWTQADAEALERAEEQLREVFGDGRQPLPVMREKLDAMMTSLPLPEDAAVAE
VSAGGVPALRVSAGAVDDSAAVVWLHGGGYLIGSPTGYRGVAAAVSAACGHPVIVPDYRL
APEHPFPAAVEDAHAVMEWAAVQFGPRWVLAGDSAGGGLTVASLIRARDTGTAVPAAAVL
VSPLADFTASGESFDTHAEADLAISRRSVQGLAAAYLRDHDPRDPLASPVFGALDRLPAT
LIQVSDREVLLDDAKALHAAMQRGGSASTLSIYSGVCHAWPMFVAYMPRAQRAVAEIGAF
ARASVG
NT seq 921 nt   +upstreamnt  +downstreamnt
atgagtgcgttgccttccgacgacgactggacgcaggcggacgccgaggcgctcgagcgg
gccgaggagcagctgcgggaggtattcggcgacgggcgccaaccgctgcccgtgatgcgc
gagaagctcgacgcgatgatgacctcgcttccgctgcccgaggacgcggcggtggccgag
gtgtcggccggtggagtcccggcgctgcgcgtcagcgccggcgcggtcgacgacagcgcc
gcggtggtgtggctgcacggcggcggctacctcatcgggtcgccgacgggatatcgcggc
gtcgccgcggcggtgtcggcggcctgcgggcacccggtgatcgtgccggactaccgactg
gccccggagcaccccttcccggccgccgtcgaggacgcccatgccgtgatggagtgggcc
gcagtgcagttcggaccccgctgggtgctggccggtgattccgccggcggcgggctgacc
gtggcatccctgatccgcgcgcgcgacacaggcaccgcggtgcccgcggccgcggtcctg
gtgtcgccgctggccgacttcaccgcctccggggagagcttcgacacccacgccgaggcc
gatctggcgatttcccggcgctcggtgcaggggttggccgcggcctaccttcgggatcac
gatccgcgggatccgttggcctcgccggtgttcggcgcgctcgatcggctgccggcgacg
ctcatccaggtcagcgaccgcgaggtgctgctggatgacgccaaggcgttgcacgccgcg
atgcagcgcgggggatcggcctcgacgttgtcgatctactcgggtgtgtgccacgcctgg
ccgatgttcgtcgcgtacatgccgcgcgcgcagcgggcggtcgccgagatcggcgccttc
gcgcgtgcctcggtgggctga

KEGG   Mycolicibacterium chitae: MCHIJ_02000
Entry
MCHIJ_02000       CDS       T06603                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_02000
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MCHIJ_02000
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     MCHIJ_02000
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase Peptidase_S9 Lipase_3
Other DBs
NCBI-ProteinID: BBZ00763
Position
complement(187088..187975)
AA seq 295 aa
MAEQRVIDAVAQAYSFAAADATIDQIRSGYDASMARAGISNSVTVSQDVIGGVPGAWFRP
AGTVGGVVLHLHGGGFRFGSSRSHGPLAAELAAAAAVAVFVADYRLAPEHPFPAAVDDAV
AALAALIADHGAEHVVISGDSAGGGLALAALLAVKSRGGQLPAAATMQSMWADLTMRSPS
VTERAGRDPLMTREQLDANAADYLGVHDPADPLASPVYGDLSGLPPLYLQVGTEEILHDD
TTRVAEAIRATGGRATVEVYDGMPHVHQILLGDLPEAHSAISATADFIRDVLAIQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcggaacaacgcgtgatcgacgctgtggcgcaggcgtattcctttgcggccgcggac
gcaacgatcgatcagattcgatcgggctacgacgccagcatggcgcgggcgggtatctcg
aactcggtgacggtgagccaggacgtgatcgggggagtgccgggagcctggttccggccc
gccgggaccgtcggcggggtggtcctgcatctgcacgggggaggtttccggttcggctcg
agccgcagccacggccccttggcggccgagttggccgcggcggccgcggtggcggtgttc
gtcgcggactaccggctggcccccgaacatccgtttcccgcggccgtcgatgacgcggtg
gccgcgctggccgcgttgatcgccgaccatggtgcggaacacgtggtgatttccggagat
tcggccgggggtggactggcgctggccgccctgctggcagtcaagagccgcggcggccaa
ctgcccgcggccgcaaccatgcagtcgatgtgggccgacctgaccatgcgcagtccgtcg
gtgaccgagcgcgccggccgggatcccttgatgacccgggaacagctggacgccaacgcc
gccgactacctcggcgtccacgatccggcggatccgctggcgtcgccggtgtacggcgac
ctttccggactgccgccgctgtacctgcaggtcggcaccgaggagatcctgcacgacgac
accacccgggtcgccgaggccatccgagcgacgggcggccgggccaccgtcgaggtgtac
gacgggatgccgcacgtgcaccagatcctgttgggcgacttgcccgaggcacactcggcg
atctcggccaccgcagacttcatccgcgacgttctcgctatccagtaa

KEGG   Mycolicibacterium chitae: MCHIJ_02190
Entry
MCHIJ_02190       CDS       T06603                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_02190
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MCHIJ_02190
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     MCHIJ_02190
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase Hydrolase_4 Peptidase_S9
Other DBs
NCBI-ProteinID: BBZ00782
Position
complement(212235..213131)
AA seq 298 aa
MARTEALDRVEQMYVNGFPDPATASVEDLREAYDNLLLQFPLPEGVEPVEGEIAGVPVLY
VTAEDATRDKVLAWFHGGGYVLGSARGFQDLGHNLSRAAGVTVVLPDYRRAPENKFPAAV
DDGVAVIAELVSTYGADNVTVGGDSAGGGLTLAALTVLRDQGASLPAASVFISPLLDFTA
TGASVDLYDGKDVAVSRGSIANLREAYLQGHDPQDPLASPVFADLGGLPPALFMVGSHEV
LLDDSNRAAMAITERGGTAAVSLYDDMVHVWPLFASILPEGVQAADEAGAFVRKHLKD
NT seq 897 nt   +upstreamnt  +downstreamnt
gtggcgagaaccgaggcgttggaccgcgtcgagcagatgtatgtgaacgggtttcccgat
ccggcgacggcaagcgtcgaggatctgcgtgaggcctacgacaacctattgctgcagttc
ccactgcccgagggcgtcgaacccgtcgagggggagatcgccggggtgcccgtgctgtac
gtgaccgccgaggacgccacccgcgacaaggtgctcgcgtggttccacggtggcggctac
gtgctgggcagcgcccgcggtttccaggatctgggccacaacctgtcgcgcgcggccggc
gtcacggtggtgctgccggactatcggcgcgccccggagaacaagtttcccgccgcggtc
gacgacggcgtcgcggtgatcgccgagttggtctcgacctacggggccgacaacgtcacc
gtcggcggcgattccgccggtggcggactgacgctggcggcgctgacggtcctgcgggac
cagggtgcgtcgctgccggccgcgtcggtgttcatctcgccgctgctcgacttcaccgcg
accggcgccagcgtggacctctacgacggcaaagacgttgcggtgtcgcggggttcgatc
gccaatctgcgcgaggcctacctgcagggccacgacccgcaggacccgctggcctcgccg
gtgttcgccgacctgggcggcctgcccccggcgctgttcatggtcggttcccatgaggtg
ctgctcgacgactccaaccgcgcggcgatggcgatcaccgaacggggtggcaccgcggcc
gtctcgctctacgacgacatggtccacgtctggccgttgttcgcctcgatcctgccggag
ggcgtccaggccgccgacgaggccggcgccttcgtgcgtaagcacctcaaagactag

KEGG   Mycolicibacterium chitae: MCHIJ_50780
Entry
MCHIJ_50780       CDS       T06603                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
mcht00930  Caprolactam degradation
mcht01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_50780
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MCHIJ_50780
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     MCHIJ_50780
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Peptidase_S9 Chlorophyllase2
Other DBs
NCBI-ProteinID: BBZ05641
Position
5283427..5284353
AA seq 308 aa
MTIGNLGSTDTNLPAPNEAATAIAVEAYAPWRRPDIDVAARRRGFDRMLPEPAADVSVTE
DSIGGVEGRWVSVPESGEATVLYLHGGGGILGSSYGYRDLASRIARSGGARVFVPDYALA
PENPFPAGLNDARAAYNALVQELGGRTEKLVMAGDSAGGGMAVSTIATVIAEKKPLPAAV
VALSPFTDMTLSGESMTRFGEVDPLISRTAAEQMAGTYLAGHNARDPRVSPVFADFAGFP
PLLVQVGACELLLDDSVRLAEAAKAAGGQVELHIADGLFHVFHMFAAQLPEAQQALETVG
AFIRMYTS
NT seq 927 nt   +upstreamnt  +downstreamnt
gtgaccataggaaacctgggtagcacggacaccaatcttccggcccccaacgaggcggcc
actgccattgcagtggaggcctatgccccatggcgccggccggacattgatgtggcggcc
aggcgccgcggattcgaccggatgctgcccgaaccggccgccgacgtgtcggtcacggag
gacagcatcggaggtgtggaaggacgctgggtatcggtgcccgaatccggcgaggcgacc
gtgctctacctacacggtggcggtggcatcctgggttcgtcttacggctaccgtgacctc
gcctcgcgcattgcgcggtccggcggtgccagggttttcgtcccggactacgcgttggca
cccgaaaatccgttccccgccggtctgaacgacgctcgcgccgcctacaacgcactggtg
caggagttgggcggtaggaccgaaaagctggtaatggcaggggattctgccggtggcggg
atggccgtctcaacgatcgccaccgtgatcgccgagaagaaaccgttgccggccgctgtg
gtggcgctgagcccgttcaccgatatgaccttgtcgggtgagtcgatgacgcggttcggc
gaggtcgaccccctcatctcacgcacggcagccgaacagatggccggcacatacctggcc
ggccacaacgcgcgggatccccgggtgtcgccggtgttcgccgacttcgccgggtttcca
ccgctgctggtgcaagttggggcttgcgaactgctcctcgacgattcggtgcggctggcc
gaggccgccaaggccgcgggcggtcaggtcgagctccacatcgccgacggcttgttccac
gtgttccacatgttcgccgctcagttgcccgaggcgcaacaggcactcgagaccgtcggc
gcattcatccgcatgtacacgagctga

DBGET integrated database retrieval system