KEGG   Mycolicibacterium chitae: MCHIJ_07060
Entry
MCHIJ_07060       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_07060
   00053 Ascorbate and aldarate metabolism
    MCHIJ_07060
   00620 Pyruvate metabolism
    MCHIJ_07060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_07060
   00561 Glycerolipid metabolism
    MCHIJ_07060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_07060
   00310 Lysine degradation
    MCHIJ_07060
   00330 Arginine and proline metabolism
    MCHIJ_07060
   00340 Histidine metabolism
    MCHIJ_07060
   00380 Tryptophan metabolism
    MCHIJ_07060
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_07060
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_07060
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_07060
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_07060
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_07060
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ01269
Position
709549..711030
AA seq 493 aa
MTQTSAAALKTDYDKLFIGGRWVAPSSSEIIEVFSPATGEKVGQVPLATKTDVDAAFAAA
RKAFDEGPWPRKTPHERQAVIAKAVELIEARADEFKRLLTLETGQPQTIVDMMQYGAAMS
TLQFYASAADKFAWKDIRDGAYGQTLVLKEPIGVVGAVVAWNVPFFLAANKLGPALLAGC
TIVLKPAAETPLTTNLMAEVFAEAGLPEGVLSVVPGGPETGRALTDNPEIDKFTFTGSSA
VGKEIGKIAAERLKPCTLELGGKSAAIILEDADLDSTLPMLVFSGLMNSGQACVGQTRIL
APRSRYDEVVEKLGNAVSAMPAGLPDDPGTVIGPLISEKQRERVEGYIKKGVEEGARIVA
GGGRPEGMDTGWFVQPTVFADVDNSMTIAQEEIFGPVLAVIPYEDEADAVRIANDSVYGL
AGSVYTTDNKKALEIAAQIRTGTYGVNMYAFDPGAPFGGYKNSGVGRECGPEGIAGYCES
KSVLLPFGYTPED
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacacagacttcggcagctgccctcaagaccgactacgacaagctgttcatcggcgga
cgttgggtcgcaccgtcctcgtcggagatcatcgaggtgttctcgccggccaccggcgag
aaggtcggtcaggtgccgctggccaccaagaccgacgtcgacgccgccttcgccgcggcc
cgcaaggccttcgacgagggaccgtggccgcgcaagacgccgcacgagcggcaggccgtg
atcgccaaggccgtcgaactgatcgaggcccgcgccgacgagttcaagcgcctgctcacc
ctggagaccgggcagccgcagaccatcgtcgacatgatgcagtacggcgcggccatgtcg
acgctgcagttctacgcctcggcggccgacaagttcgcctggaaggacatccgcgacggc
gcctacggtcagacgctggtgctcaaggagccgatcggcgtggtgggtgccgtcgtcgcc
tggaacgtgccgttcttcctggccgccaacaagctcggtccggcgctgctggccggctgc
accatcgtgctcaagccggccgccgagaccccgctgacgaccaacctgatggccgaggtg
ttcgccgaggccgggctgcccgagggcgtgctgtcggtggtgcccggcgggcccgagacc
ggccgcgcgctcaccgacaaccccgagatcgacaagttcaccttcaccgggtcctcggcc
gtcggcaaggagatcggcaagatcgccgccgagcggctcaagccgtgcacgctggaactc
ggcggcaagtccgcggccatcatcctcgaggacgccgacctggattcgacgctgcccatg
ctggtgttctccgggctgatgaactccgggcaggcgtgtgtgggtcagacccgcatcctc
gcgccgcgctcccgctacgacgaggtcgtcgagaagttgggcaacgccgtatcggcgatg
ccggccggcctgccggacgacccgggcaccgtgatcgggccgctgatcagcgagaagcag
cgcgaacgcgtcgagggctacatcaagaagggcgtcgaggagggcgcccgcatcgtggcc
ggcggcggccgtcccgaggggatggacaccggctggttcgtgcagcccacggtgttcgcc
gacgtggacaactcgatgaccatcgcccaggaggagatcttcggcccggtgctggcggtg
atcccctacgaggacgaggccgacgcggtgcgcatcgccaacgactcggtgtacgggctg
gccgggtcggtgtacaccaccgacaacaagaaggccctcgagatcgcggcccagattcgc
accggcacctacggcgtgaacatgtacgccttcgacccgggcgcgccgttcggcgggtac
aagaactccggcgtgggccgcgagtgcgggcccgagggcatcgcggggtactgcgagtcc
aagtccgtgctgctgcctttcggctacaccccggaggactga

KEGG   Mycolicibacterium chitae: MCHIJ_08290
Entry
MCHIJ_08290       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_08290
   00053 Ascorbate and aldarate metabolism
    MCHIJ_08290
   00620 Pyruvate metabolism
    MCHIJ_08290
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_08290
   00561 Glycerolipid metabolism
    MCHIJ_08290
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_08290
   00310 Lysine degradation
    MCHIJ_08290
   00330 Arginine and proline metabolism
    MCHIJ_08290
   00340 Histidine metabolism
    MCHIJ_08290
   00380 Tryptophan metabolism
    MCHIJ_08290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_08290
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_08290
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_08290
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_08290
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_08290
SSDB
Motif
Pfam: Aldedh DRTGG
Other DBs
NCBI-ProteinID: BBZ01392
Position
complement(845498..846907)
AA seq 469 aa
MTTEISKESAPATTPVDIPAVVAGVRKAYATGRTRSIEWRKQQLRALEKLVLENESVIAD
ALAEDLGRAPFEAWLADIASTAGEAKNAAKNVGKWAKRRYRLLESSQLPGRGWVEYEPFG
TVLIIGAWNFPFALTLGPAVGAIAAGNTVVLKPSEVAPASSAVMADLVPRYLDPEAVVVV
EGDGSVSQELINQGFDRVFFTGGTEIGRKVYESAAAHLSPVTLELGGKSPVIVAADADIE
IAAKRIAWTKLINSGQICIAPDYVLAEASIKDKLVDEITKAVTKFESKNPEGKRIVNERH
FARLTNALAATKGNVVLGGGSDPENIKIQPTLVVDPDPAEPLMTDEIFGPILPIVTVQSI
DDAIDFVNARPKPLAAYLFTKTKAIRERIIREVPAGGMVINQLLFHFATAKLPFGGVGPS
GMGSYHGKFGFEEFSHRKTVMTKPTRPDLISMIYPPYTEKAWKMARRLF
NT seq 1410 nt   +upstreamnt  +downstreamnt
gtgaccaccgaaatttccaaagaatccgcacctgcgacgacccccgtggacattccggcc
gtcgtcgcgggcgtccgcaaggcctacgcgaccggccgcacccgcagcatcgaatggcgc
aaacagcagctccgcgcgctggagaagctggtcctcgagaacgagtcggtgatcgccgac
gcgctggccgaggacctcggccgcgcgccgttcgaggcgtggctggccgacatcgccagc
accgccggcgaggccaagaacgccgccaagaacgtcggcaagtgggccaagcgccgctac
cggctgctggagtcctcgcagctgcccggccggggctgggtcgagtacgagccgttcggc
accgtgctgatcatcggcgcctggaacttcccgttcgccctgacgctgggcccggccgtc
ggcgcgatcgccgccggcaacaccgtggtgctcaagccgtcggaggtggccccggcctcc
tcggccgtgatggccgacctggtgccccggtacctggaccccgaggccgtcgtggtcgtc
gagggggacggctcggtcagtcaggaactcatcaaccagggcttcgaccgggtgttcttc
accggcggcaccgagatcggccgcaaggtctacgagagcgccgcggcgcacctgagcccg
gtcaccctcgaactcggcggcaagagcccggtgatcgtcgcggccgacgccgacatcgag
atcgcggccaagcgcatcgcctggaccaagctgatcaactccgggcagatctgcatcgcc
ccggactacgtgctggccgaggcgagcatcaaggacaagctggtcgacgagatcaccaag
gccgtcaccaagttcgagtccaagaaccccgagggcaagcggattgtcaacgagcggcac
ttcgcgcggctgaccaacgcgctggccgcgaccaagggcaacgtggttctcggcggtggc
tccgacccggagaacatcaagatccagccgacgctggtggtggacccggacccggccgaa
ccgctgatgaccgacgagatcttcggccccatcctgcccatcgtcaccgtgcaatccatc
gacgacgcaatcgatttcgtcaacgcccggcccaagccgctggcggcctacctgttcacc
aagaccaaggccatccgcgagcggatcatccgcgaggtgccggccggcggcatggtgatc
aaccagttgctgttccacttcgcgaccgccaagctgccgttcggcggggtcggcccgtcc
gggatgggctcctaccacggcaagttcggcttcgaggaattcagccaccgcaagaccgtg
atgaccaagccaacccgacccgacttaatctcgatgatctacccgccgtatacagagaag
gcgtggaagatggcgcgacggctgttctga

KEGG   Mycolicibacterium chitae: MCHIJ_10580
Entry
MCHIJ_10580       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_10580
   00053 Ascorbate and aldarate metabolism
    MCHIJ_10580
   00620 Pyruvate metabolism
    MCHIJ_10580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_10580
   00561 Glycerolipid metabolism
    MCHIJ_10580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_10580
   00310 Lysine degradation
    MCHIJ_10580
   00330 Arginine and proline metabolism
    MCHIJ_10580
   00340 Histidine metabolism
    MCHIJ_10580
   00380 Tryptophan metabolism
    MCHIJ_10580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_10580
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_10580
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_10580
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_10580
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_10580
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ01621
Position
complement(1079967..1081448)
AA seq 493 aa
MPEAAAPYESRMLIDGKLVDGEAGVFTNINPATEEVLGEVADASIADMGRAIDAARRSFD
ETDWSTNHALRKRCLLQLHDAIAGEIEDLREELIREVGAPRAVTHGPQLDAPFADGLKYP
AGLIDTFPWETDLGDTVVSVTGVNTTRKVWHEPVGVVGAIVPWNFPFEVSINKLGQALAA
GNTVVLKPAPDTPFNATRLGRLIAENTDIPAGVVNVVTASDHLVGEELTTSPKVDMISFT
GSTAVGKRIMEKGAATMKRLFLELGGKSATIVLDDADFNTACLIGIGPLMHAGQGCAAPT
RMLLPRSRYDEGIAILRGIYENIAAGDPQDPGTLCGPVISAKQQARILGYIRKGVDEGAT
MLVGSTEAPTGFDKGFWVSPTLFTDVDNSMVIAQEEIFGPVLAVIPYEDEDDAVRIANDS
PYGLAGNVMSGSLDRSLAVAKRLRAGFIGLNGTAGYGADTPFGGYKDSGVGRQNGLVGFS
QYTEVKSVAYPAQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcctgaggccgctgcgccctacgagtcccgaatgctgatcgacggcaagctcgtcgac
ggcgaggcgggtgtgttcaccaacatcaatcccgccaccgaggaggtgctgggcgaggtc
gccgacgcctcgatcgccgacatggggcgggccatcgacgccgcccgccgttcgttcgac
gagaccgactggtcgaccaaccacgcgctgcgcaaacgctgcctgctgcagttgcacgac
gcgatcgccggcgaaatcgaggacctgcgcgaggaattgatccgggaggtcggcgccccg
cgcgcggtgacccacggtccgcagctggacgccccgttcgccgacgggctcaagtatccc
gccgggttgatcgacaccttcccgtgggagaccgacctcggcgacaccgtggtgtcggtg
accggcgtcaacaccacccgcaaggtctggcacgaaccggtcggagtggtcggggccatc
gtgccgtggaactttcccttcgaggtcagcatcaacaagctcggccaggcgctggcggcg
ggcaacaccgtggtcctcaagcccgcccccgacaccccgttcaacgccacccggctcggc
cggctgatcgccgagaacaccgacatcccggccggtgtggtgaacgtggtcacggcctcg
gaccacctcgtcggcgaggaactgacgacctcgccgaaggtcgacatgatctccttcacc
ggttcgaccgcggtgggcaagcggatcatggaaaagggcgccgccaccatgaagcggctg
ttcctggaactcggcggcaagtcggcgaccatcgtgctcgacgacgccgacttcaacacg
gcctgcctgatcgggatcggcccgctgatgcacgccggccagggctgtgccgcccccacc
cgaatgctgctgccgcgctccaggtacgacgagggcatcgcgatcctgcggggcatctac
gagaacatcgccgcgggggacccgcaggacccgggcacactgtgcggcccggtgatctcg
gccaagcagcaggcccgcatcctcggctacatccgcaagggcgtcgacgagggcgcgacg
atgctggtgggcagcaccgaggcgccgacgggcttcgacaagggattctgggtcagccca
acccttttcaccgatgtcgacaacagcatggtcatcgcgcaggaggagatcttcggcccg
gtgctggcggtgatcccgtatgaggatgaggacgacgcggtgcgcatcgccaacgacagt
ccctacggtctggccggcaacgtgatgtcgggctcgctggaccggtcactggcggtcgcc
aagcggctgcgcgcggggttcatcggactcaacggcaccgccggctacggggccgacacc
ccgttcggcggctacaaggacagcggcgtcggccgacagaacggcctcgtcggcttcagc
cagtacaccgaggtgaaatcggtggcctacccggctcaatag

KEGG   Mycolicibacterium chitae: MCHIJ_11470
Entry
MCHIJ_11470       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_11470
   00053 Ascorbate and aldarate metabolism
    MCHIJ_11470
   00620 Pyruvate metabolism
    MCHIJ_11470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_11470
   00561 Glycerolipid metabolism
    MCHIJ_11470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_11470
   00310 Lysine degradation
    MCHIJ_11470
   00330 Arginine and proline metabolism
    MCHIJ_11470
   00340 Histidine metabolism
    MCHIJ_11470
   00380 Tryptophan metabolism
    MCHIJ_11470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_11470
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_11470
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_11470
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_11470
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_11470
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: BBZ01710
Position
1172120..1173592
AA seq 490 aa
MTSTELTTRKLFIDGAWTEGATEEALSVVNPATEETIAEVPQASPADIDAAVGAARRAFD
DGPWPRMSPLERAKVLADMADELSRRRAELVELSIAEAGSTRMLADILQVGTPIDHFADL
AHRVLPQFAFDEPARPVFGNGIGQGQILREPYGVAALITAFNFPFLLNLAKVGPALAAGC
TAVLKSSPYTPLEALVLGEVAEAAGLPPGTLNIVTGDIDAGQRLTQHPDVDIVSFTGSDT
VGRKVYAQGAESIKKVVLELGGKSANIILDDADLDKVLESVLAGIITHAGQGCALLTRIL
VHESLHDELIARIVGVLGFIGVGDPSDPATVMGPLIRDVQRQRVEELIASGVAQGAEIAF
GGKRPAHLDRGYYLEPTLFVGVDNGMRIAQEEFFGPVGVVIPFRDDADAVRIANDSRYGL
AGGVWSADPVRAAEVARKLRTGMVVINGGGGGLNPGAPFGGYKQSGIGREFGEFGLSEYL
QHKALQWPVG
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgacctcgaccgaattgaccacccgcaaactgttcatcgacggtgcgtggaccgaaggc
gccaccgaggaggccttgtcggtggtcaaccccgccaccgaagagaccatcgccgaggtc
ccgcaggccagccccgcggacatcgacgccgcggtgggcgcggcccgccgcgccttcgac
gacggcccctggccccggatgagccccctggagcgggccaaggtcctcgccgacatggcc
gatgagctgtcgcggcgccgcgccgagctggtggagctgagcatcgccgaggccggttcc
acccggatgctcgccgacatcctccaagtcggcactcccatcgatcatttcgcggacctc
gcgcaccgggtgctgccccagttcgcgttcgacgagccggcgcggccggtcttcggcaac
ggcatcggtcagggacagatcctgcgggagccctacggggtggcggcgctgatcaccgcg
ttcaacttcccgttcctgctcaatctcgcgaaggtggggcccgcgctggctgccggctgt
accgcggtgctgaagtcctcgccctacacgccgctcgaggcgctggtgctcggcgaggtc
gccgaggccgcgggcctgccgcccggcacgctcaacatcgtcaccggtgacatcgacgcc
ggtcagcggctcacccagcatccggacgtcgacatcgtcagcttcaccggctcggatacg
gtgggccgcaaggtgtacgcccaaggcgccgagtccatcaagaaggtggtactcgaactg
ggcggcaagtcggccaacatcattctcgacgacgccgacctggacaaggtgctcgaaagc
gtgctggcgggcatcatcacccacgccgggcagggctgcgcactgctgacccgcatcctg
gtgcacgagtcgctgcacgacgagttgatcgcccggatcgtcggcgtgctgggcttcatc
ggggtcggggacccgtcggacccggccacggtgatgggcccgctgatccgcgacgtacag
cggcagcgggtggaggaactgatcgcctccggcgtcgcccagggcgccgagatcgcgttc
ggcggcaagcgtcccgcgcatctggaccgcggctactacctcgagccgacgctgttcgtc
ggggtcgacaacggaatgcggatcgcccaggaggaattcttcgggccggtcggggtggtc
atcccgttccgggacgacgccgacgccgtccgcatcgccaacgacagccggtacggtctg
gccggcggcgtctggtccgcggacccggtccgggccgccgaggtggcgcgcaagctgcgg
accggcatggtggtcatcaacggcggcggcggtggcctcaacccgggcgcaccgttcggc
ggctacaaacaaagtggtatcggtcgcgagttcggcgagttcgggctctcggagtacctg
cagcacaaggcccttcagtggccggtcggctga

KEGG   Mycolicibacterium chitae: MCHIJ_13890
Entry
MCHIJ_13890       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_13890
   00053 Ascorbate and aldarate metabolism
    MCHIJ_13890
   00620 Pyruvate metabolism
    MCHIJ_13890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_13890
   00561 Glycerolipid metabolism
    MCHIJ_13890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_13890
   00310 Lysine degradation
    MCHIJ_13890
   00330 Arginine and proline metabolism
    MCHIJ_13890
   00340 Histidine metabolism
    MCHIJ_13890
   00380 Tryptophan metabolism
    MCHIJ_13890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_13890
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_13890
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_13890
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_13890
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_13890
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ01952
Position
complement(1440566..1441990)
AA seq 474 aa
MREYLKFYINGQWVDPIEPKTLDVDNPTTEQVSGRIAIGGAADVDAAVEAARKAFTTWSQ
TTRDERLALLGAVLAEYQKRSADLADAVSEEMGAPASLAAGPQVQMGMGHLATAIEALKK
FQFEEEHGSTLVVKEPIGVCGLITPWNWPINQIACKVFPAMATGNTMVLKPSEVAPYSAQ
IFTEIIDAAGVPAGVYNLVYGDGPGVGTALASHPDIDMVSFTGSTRAGIEVARNAAPTVK
RVTQELGGKSPNIVLDDADFAKSVAAGVSVMMVNSGQSCNAPSRMLVPNSRMEEAAAIAR
DIAGAVKVGDPAEKTAIGPVASKVQFDKIQGLLQKGADEGATVVVGGVGRPDGLDTGYYV
KPTVFANVTNDMTIAQEEIFGPVLCILGYDDLDQAVEIANDTEYGLAGYVSGADLETARA
LVRRIRAGSVAINHNFDISAPFGGYKRSGNGREWGHFGFDEFLETKAAVGYAPQ
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcgtgagtatctgaagttctacatcaacggccagtgggtggatccgatcgagcccaag
accctcgacgtcgacaacccgaccaccgagcaggtctccgggcggatcgcgatcggcggc
gcggccgatgtcgacgccgcggtggaggcggcccgcaaggcgttcaccacctggtcgcag
accacccgcgacgagcgcctcgcgctgctgggcgccgtgctggccgagtaccagaagcgt
tccgccgacctggccgacgcggtcagcgaagagatgggcgccccggcgtccctggcggcc
ggcccgcaggtccagatgggcatgggacacctggccaccgccatcgaggcgctgaagaag
ttccagttcgaggaggaacacggcagcaccctggtggtcaaggagcccatcggggtctgc
ggcttgatcacgccgtggaactggcccatcaaccagatcgcctgcaaggtgttccccgcg
atggccaccggcaacaccatggtgctcaagccgtcggaggtggcgccctactccgcgcag
atcttcaccgagatcatcgacgcggccggggttcccgccggggtgtacaacctggtttac
ggcgacggacccggcgtgggcaccgcgctggccagccaccccgacatcgacatggtgtcc
ttcaccggatccacccgcgccggcatcgaggtcgccaggaacgcggcgccgacggtcaag
cgggtcacgcaggaactcggcggtaagagccccaacatcgtgctcgacgacgccgacttc
gccaagagcgtggccgccggggtgtcggtgatgatggtcaacagcgggcagagctgcaac
gccccgtcgcggatgctcgtcccgaactcccggatggaggaggccgccgccatcgcccgc
gacatcgcgggcgcggtcaaggtcggcgacccggcggagaagaccgcgatcgggcccgtg
gcctcgaaggtgcagttcgacaagatccaggggctgctgcagaagggcgccgacgagggc
gccaccgtcgtcgtcggcggcgtcggtcgccccgacggactcgacaccggctactacgtc
aaaccgaccgtgttcgccaatgtcaccaacgacatgacgatcgcccaggaggagatcttc
ggcccggtgctctgcattctgggctacgacgatctcgaccaggccgtggagatcgccaac
gacaccgagtacggactggccggttacgtgtcgggcgcggatctggagaccgcccgcgcc
ctggtccgccgcatccgggccggctcggtcgcgatcaaccacaacttcgacatcagcgca
ccgttcggcgggtacaagcgcagcggcaacggccgcgagtggggtcacttcgggttcgac
gagttcctggagacgaaggccgcggtggggtacgcgccgcagtag

KEGG   Mycolicibacterium chitae: MCHIJ_20770
Entry
MCHIJ_20770       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_20770
   00053 Ascorbate and aldarate metabolism
    MCHIJ_20770
   00620 Pyruvate metabolism
    MCHIJ_20770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_20770
   00561 Glycerolipid metabolism
    MCHIJ_20770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_20770
   00310 Lysine degradation
    MCHIJ_20770
   00330 Arginine and proline metabolism
    MCHIJ_20770
   00340 Histidine metabolism
    MCHIJ_20770
   00380 Tryptophan metabolism
    MCHIJ_20770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_20770
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_20770
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_20770
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_20770
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_20770
SSDB
Motif
Pfam: Aldedh PAS_8 RRM_occluded
Other DBs
NCBI-ProteinID: BBZ02640
Position
2171130..2172596
AA seq 488 aa
MALLADRNSQLLVDGKLVAGSAGTFTTVNPATEEVLGTAADADAADMGAAIEAARRAFDD
TDWSRNTELRVRCLRQLRQAMQEHIEDLRELTIAEVGAPKMLTSGGQLEGPVDDLSFCAD
TAESYAWNTDLGHATPQGIPTNRTIAREAVGVVGAITPWNFPHQINLAKIGPALAAGNTL
VLKPAPDTPWCAAVLGELITEHTDFPAGVINIVTSSDHAVGALLSKDPRVDMVSFTGSTA
TGRSVMTDAAATIKKVFLELGGKSAFLVLDDADLAGACSMAAFTAAMHAGQGCAITTRLV
VPRASYDEAVEAAAATMAGLKPGDPTSKRTICGPVISARQRDRVQSYLDLAIEEGGRFAC
GGGRPADQPKGFFIEPTVIAGLDNDARVAREEIFGPVLTVIAHDGDDDAVRIANDSPYGL
SGTVFSGDPERAAAVAARLRVGTVNVNGGVWYAADAPFGGYKQSGVGREMGVAGFEEYTE
IKVIATMA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgttactcgccgaccgcaacagccagctactcgtcgacggcaagctggtcgccggc
agcgccgggacgttcaccaccgtcaacccggccaccgaggaggtgctcggcaccgcggcc
gacgccgacgcggcggacatgggcgccgccatcgaggccgccaggcgcgccttcgacgac
accgactggtcccgcaacaccgagctgcgggtgcgctgcctgcgacagttgcgtcaggcc
atgcaagaacacatcgaggacctgcgcgagctgaccatcgccgaggtcggcgcgccgaag
atgctgacctccggcggccagctcgaagggccggtcgacgacctgagtttctgcgccgac
accgccgagtcctacgcctggaacaccgatctcggacacgcgacgccgcagggcattccg
accaaccgcacgatcgcacgcgaagccgtcggggtggtcggggccatcacgccgtggaac
ttcccgcatcagatcaacctcgccaagatcggtccggcgctggccgcgggcaacaccctg
gtgctcaagcccgcacccgacaccccctggtgcgcggcggtgctcggcgagctgatcacc
gaacacaccgacttcccggccggggtgatcaacatcgtgacctccagcgaccacgcggtg
ggcgcgctgctgtcgaaagaccctcgggtggacatggtttcgttcaccgggtcgacggca
acgggccggtcggtgatgaccgacgccgctgccaccatcaagaaggtcttcctcgaactc
ggcggcaaatcggccttcctggtgctcgacgacgccgacctggccggcgcgtgctcgatg
gcggcgttcaccgccgcgatgcatgccgggcagggctgcgccatcaccacccggctggtg
gtgccgcgggcgagctacgacgaggccgtcgaggccgcggcggcgaccatggcggggctc
aagcccggcgatcccaccagcaaacgcaccatctgcgggccggtgatctccgcgcggcag
cgcgaccgggtgcagtcctacctggacctcgcgatcgaggagggcggccggttcgcctgc
ggcggtggacgtcccgccgatcagcccaagggcttcttcatcgaaccgaccgtcatcgcc
ggcctggacaacgacgcccgggtggcgcgcgaggagatcttcggcccggtcctgaccgtg
atcgcccacgacggcgacgacgacgccgtgcggattgccaacgactcgccctacggcctg
tccggcacggtgttctcgggcgatccggagcgcgctgccgcggtggccgcccggctgcgg
gtgggcaccgtcaacgtcaacggcggggtctggtacgcagcggacgccccgttcggcggg
tacaagcagtccggggtcggccgcgagatgggtgtggccggattcgaggaatacaccgag
atcaaggtgatcgccacgatggcttag

KEGG   Mycolicibacterium chitae: MCHIJ_21110
Entry
MCHIJ_21110       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_21110
   00053 Ascorbate and aldarate metabolism
    MCHIJ_21110
   00620 Pyruvate metabolism
    MCHIJ_21110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_21110
   00561 Glycerolipid metabolism
    MCHIJ_21110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_21110
   00310 Lysine degradation
    MCHIJ_21110
   00330 Arginine and proline metabolism
    MCHIJ_21110
   00340 Histidine metabolism
    MCHIJ_21110
   00380 Tryptophan metabolism
    MCHIJ_21110
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_21110
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_21110
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_21110
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_21110
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_21110
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ02674
Position
complement(2209121..2210605)
AA seq 494 aa
MTQTQSGTGILAGEQRMLIDGELRHTDGGALFDVVHPGNEEVVGQVADGTTADMGRAVGA
ARRAFDDTDWSRDLDFRYHCLMQLHAALERNKERLRRIVVTEVGCPISVTGSQIEDPIDE
VRHWAEHGRDFEYLVDTGIHKAPMGTARRTISYEPVGVVGAITPWNVPFYLNIAETVPAL
MAGNTVVLKPAQLTPWSGSELGRIIAEETDIPAGVFNVVTSNANEVGAALSADPRVDMIT
FTGSTATGRAILAAAAPTVKRTMMELGGKSAHIVLDDAKLEKCLPMAAMVACVMSGQACI
MASRILLPRSRYDEGIEILKAAMAATAVGDPWDPAMLQGPQISETQRQKVLGLIRSGIDS
GARLITGGGVPEALPVGYYTQPTLLADVDPDSQVAQEEIFGPVLTVIPYDTDDQAVAIAN
NSIYGLSGEVTGVDTERAFCIARRLRTGNVTVNGRSHFGITSPFGGTKQSGLGRRNGAEG
FKEYLESKTIGHPA
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgacccaaacacagagtggcaccggcattctcgccggtgagcagcggatgctcatcgac
ggcgaactgcgccacaccgacgggggcgcgctgttcgacgtcgtgcaccccggcaacgag
gaggtcgtcggtcaggtcgccgacggcacgacggccgacatgggccgcgccgtcggcgcg
gcccggcgcgcgttcgacgacaccgactggtcgcgcgatctcgacttccgctaccactgc
ctgatgcagttgcacgcggcgctggaacgcaacaaggagcgcctgcggcgcatcgtcgtc
accgaggtcggctgcccgatcagcgtgaccggcagtcagatagaggacccgatcgacgag
gtacggcactgggccgagcacggccgcgacttcgagtacctggtcgacaccggcatccac
aaggccccgatggggaccgcccggcggaccatctcctacgaacccgtgggcgtggtcggg
gcgatcaccccgtggaacgtgccgttctacctcaacatcgccgagacggtccccgccctg
atggccggcaacaccgtcgtcctcaaacccgcccagctcaccccctggtcgggcagcgaa
ctcggccgcatcatcgccgaggaaaccgacatccccgccggggtgttcaacgtcgtgacc
tcgaatgccaacgaggtcggcgccgccctgagcgcggacccgcgggtggatatgatcacc
ttcaccggctccacggccaccggccgcgccatcctcgccgcggccgcgcccacggtgaag
cgcaccatgatggagctgggcggcaagtccgcccacatcgtgctcgacgacgcgaagctc
gagaagtgcctgccgatggcggccatggtcgcgtgcgtgatgtcgggtcaggcgtgcatc
atggccagccgaatcctgctgccgcgcagccgctacgacgagggcatcgaaatcctgaag
gccgccatggcggccaccgcggtgggcgatccgtgggatccggcaatgctgcaaggcccg
cagatcagcgagacccagcggcagaaggtgctcgggctgatccgctccggcatcgactcc
ggcgcgcggctgatcactggcggcggcgtccccgaggcgctgcccgtcggctattacacc
cagccgacgctgctcgccgacgtcgacccggactcccaggtggcgcaggaagagatcttc
ggtccggtactcaccgtgatcccgtacgacaccgacgaccaggccgtcgccatcgccaac
aactccatctacgggctctccggcgaagtcaccggggttgacactgaacgcgccttttgt
atcgcccggcggctgcgtaccggtaacgtgacggtcaacggacgaagccacttcggcatc
accagtccgttcggcggcaccaagcagagcggcctcggccggcgcaacggggccgagggg
ttcaaggagtacctggagagcaagaccatcgggcacccggcgtag

KEGG   Mycolicibacterium chitae: MCHIJ_29100
Entry
MCHIJ_29100       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_29100
   00053 Ascorbate and aldarate metabolism
    MCHIJ_29100
   00620 Pyruvate metabolism
    MCHIJ_29100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_29100
   00561 Glycerolipid metabolism
    MCHIJ_29100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_29100
   00310 Lysine degradation
    MCHIJ_29100
   00330 Arginine and proline metabolism
    MCHIJ_29100
   00340 Histidine metabolism
    MCHIJ_29100
   00380 Tryptophan metabolism
    MCHIJ_29100
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_29100
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_29100
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_29100
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_29100
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_29100
SSDB
Motif
Pfam: Aldedh DUF436
Other DBs
NCBI-ProteinID: BBZ03473
Position
3004053..3005555
AA seq 500 aa
MGSPESATATKQQAAPDRRLLIGGKLVETEKTFASLNPATEEVLGHAPDAGIAEAEAAIA
AARAAFDETDWSTNKELRVRCLEQLHRALVDHRAELGQLTTDEVGATPALLAGAQYDGPV
EIVRYYADLLKNTELTEDLGNVEARGALHHRWVEKEAAGVVAAIIAYNYPNQLALAKLAP
ALAAGCTVILKAAPDTPLVTLALGELIANHTDIPAGVVNVLSGADPEVGAVLTTSPDVDM
VTFTGSTPTGRAIMSAASATLKRVFLELGGKSAAIVLDDGDFNTAAVFSAFSMVTHAGQG
CALTSRLLVPRKHHDEIVELIKTNFGHVRYGDPNDPKTYMGPLISEKQRDKVDGMVQRAV
SASATLVTGGEKKGPGYFYTPTLLANVDPDSEIAQEEVFGPVLAVIAYEDDDDAVRIANN
SIYGLSGAIFGSHERALGLARRIRTGTFSINGGNYFHPDAPFGGYKQSGIGREMGAAGLE
EFQETKTFAVPVAAESGAQA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgggatcccctgagtcggcaacggcgaccaagcagcaggccgcgccggaccgtcggttg
ctcatcggcggcaagctcgtcgagaccgagaagaccttcgcgagcctcaatcccgccacc
gaagaggtgctgggtcacgcgccggacgccggcatcgccgaggccgaggccgccatcgcc
gcggcgcgggccgccttcgacgagaccgactggtcgaccaacaaggaactgcgggtgcgc
tgcctcgaacagctgcaccgcgccctggtcgaccaccgcgccgagctggggcagctgacc
accgacgaggtgggcgccacccccgcgctgctggccggcgcgcagtacgacggacccgtc
gagatcgtgcgctactacgcggacctgttgaagaacaccgagctgaccgaggacctcggc
aatgtcgaggcgcgcggcgcgctgcatcaccgctgggtggagaaggaagccgccggcgtg
gtcgcggcgatcatcgcctacaactatccgaaccagctggccctggccaagctcgccccg
gcgctggccgccggttgcaccgtgatcctcaaggccgccccggacactccgctggtcacg
ctggcgctcggcgaactgattgccaaccacaccgacatcccggccggcgtggtcaacgtg
ctctccggggccgacccggaggtcggcgccgtgctgacgaccagcccggacgtcgacatg
gtgaccttcaccggctccacgcccaccggccgggcgatcatgtccgccgccagcgccacc
ctcaagcgggtgttcctggaactcggcggcaagtccgccgcgatcgtcctcgacgacggc
gacttcaacaccgccgcggtcttctcggcgttctcgatggtcacccacgccggacagggc
tgcgcgctcacctcgcggctgctggtgccgcgcaagcaccacgacgagatcgtcgagctg
atcaagaccaacttcggccacgtccgctacggcgaccccaacgatccgaagacctacatg
ggcccgctgatcagcgagaagcagcgggacaaggtcgacggcatggtccagcgcgcggtc
tccgccagcgccaccctggtcaccggcggcgagaagaaggggccgggctacttctacacc
ccgaccctgctggccaacgtcgacccggacagcgagatcgcccaggaggaggtgttcggc
ccggtgctggcggtcatcgcctacgaggacgacgacgacgcggtgcgcatcgccaacaac
tccatctacggcctctcgggcgccatcttcggcagccacgagcgggccctcggcctggcc
cgccggatccgcaccggaacgttctccatcaacggcggcaactactttcacccggacgcg
ccgttcggtggctacaagcagtccggcatcggccgcgagatgggtgccgccggtctcgag
gagttccaggagaccaagaccttcgccgttccggtcgccgccgagtcgggagcgcaggca
tga

KEGG   Mycolicibacterium chitae: MCHIJ_37270
Entry
MCHIJ_37270       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_37270
   00053 Ascorbate and aldarate metabolism
    MCHIJ_37270
   00620 Pyruvate metabolism
    MCHIJ_37270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_37270
   00561 Glycerolipid metabolism
    MCHIJ_37270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_37270
   00310 Lysine degradation
    MCHIJ_37270
   00330 Arginine and proline metabolism
    MCHIJ_37270
   00340 Histidine metabolism
    MCHIJ_37270
   00380 Tryptophan metabolism
    MCHIJ_37270
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_37270
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_37270
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_37270
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_37270
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_37270
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ04290
Position
complement(3923342..3924826)
AA seq 494 aa
MTSVQNETGVLAGEPRMLIDGELTETAGGATFDVIHPASEQVAGTATDGTVEDMARAVGA
ARRAFDETDWSRDKDFRFNCLMQLHAALEKNQERLRRILITEVGCPVTVSGSQIESPIAE
VKHWAEHGRDFDYLVDNGVHETPLGPARRKLHYEPVGVVGAITPWNVPFYLNIAETIPAL
MAGNTVVLKPAQLTPWSGSELGRIVAEETDIPAGVFNVVTSNANEVGAALSADPRVDMIT
FTGSTATGRAILAAGAPTVKKTLLELGGKSAHIVLDDADFNSSLPLAAMMACVMSGQSCI
LPSRILLPRSRYEEGIEILKTSMANFPVGDPWTPGNMQGPQISETQRQKVLGLIKSGIDA
GARLVTGGGIPEALPVGYYTEATLLVDVDPDSQIAQEEIFGPVLTVTPYDTDDDAVAIAN
NTIYGLSGEVSSADVDRAFSVATRMRTGNVTINGKSHFGIDSPFGGTKQSGLGYRNGTHG
YQEYLAIKTIGMPE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgacgagtgtgcagaacgagaccggcgtgttggcgggcgagccgcgcatgctgatcgac
ggagagctgaccgagacggccggcggcgccacgttcgatgtgatccacccggccagcgag
caggtcgccgggaccgcgaccgacggcacggtcgaggacatggcgcgcgcggtcggtgcg
gcacggcgcgcgttcgacgagaccgactggtcccgggacaaggacttccgcttcaactgc
ctgatgcagttgcacgcggcgctggaaaagaaccaggagcggctgcggcgcatcctgatc
accgaggtcggctgtccggtcacggtcagcggcagccagatcgaaagccccatcgccgag
gtcaagcactgggccgagcacggtcgggacttcgactacctcgtcgacaacggcgtgcac
gaaactcccctgggcccggcccggcgcaagctgcactatgagcccgtcggcgtggtgggg
gcgatcactccgtggaacgtgcctttctacctcaacatcgccgagaccatcccggcgctg
atggccggcaacaccgtcgtcctcaagcccgcgcaactcaccccgtggtcgggcagcgaa
ctcggccgcatcgtcgccgaggagaccgacatccccgccggggtcttcaacgtcgtgacc
tcgaacgccaacgaggtcggcgccgccctttccgccgacccgcgggtcgacatgatcacc
ttcaccggctcgacggccaccggccgggccatcctggccgccggtgccccgacggtgaag
aagacgctgctggaactcggcggcaagtcggcccacatcgtgctcgacgacgccgacttc
aattcctcgctgccgctggcggcgatgatggcctgcgtcatgtccgggcagagctgcatc
ctgcccagccgcatcctgctgccgcgctcgcgctacgaggagggcatcgagatcctcaag
accagcatggccaacttcccggtcggtgatccctggacgccgggcaacatgcagggcccg
cagatcagcgagacccagcggcagaaggtgctcgggctgatcaaatccggcatcgatgcc
ggggcgcggctggtcaccggcggcgggattcccgaggcgctgcccgtcggctactacacc
gaggccacgctgctggtcgacgtcgacccggattctcagatcgcccaggaggagatcttc
ggcccggtcctgaccgtcacgccgtatgacaccgacgacgacgcggtcgcgatcgccaac
aacaccatctacgggctctccggcgaggtctccagcgccgatgtcgaccgcgcgttctcg
gtggccacccggatgcgcaccggcaacgtcacgatcaacggcaagagccacttcggcatc
gactcccccttcggcggcaccaagcagtccggtctgggctaccgcaacggcacccacggc
taccaggagtacctcgcgatcaagaccatcggcatgcccgaatga

KEGG   Mycolicibacterium chitae: MCHIJ_37890
Entry
MCHIJ_37890       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_37890
   00053 Ascorbate and aldarate metabolism
    MCHIJ_37890
   00620 Pyruvate metabolism
    MCHIJ_37890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_37890
   00561 Glycerolipid metabolism
    MCHIJ_37890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_37890
   00310 Lysine degradation
    MCHIJ_37890
   00330 Arginine and proline metabolism
    MCHIJ_37890
   00340 Histidine metabolism
    MCHIJ_37890
   00380 Tryptophan metabolism
    MCHIJ_37890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_37890
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_37890
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_37890
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_37890
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_37890
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ04352
Position
3991031..3992464
AA seq 477 aa
MTPITGQVYIGGQFRPSAEVTPVLEAATGTPLGDGANAGTADVDDAVSAARAALPGWRAT
PAARRAEILVALAEALKARASSTNELVTRENGMPMSLSRGVNGAFPAVLLNYYAALITAL
PEEEVRSGPTGHTTVRHEPVGVVGAITPWNYPQALAAFKLAPALAAGCPVVLKPSPETAL
DAMVFGEAATEAGLPPGVLNIVPGGTETGVHLVAHPGVDKVSFTGSTVAGRAIGEVCGRL
LRPVTLELGGKSAAIILDDADLDATLAGLRTQSFTNNGQTCYLNSRVLAPRSRYAEIVEA
LAELAGSLRVGDPLDPSTEIGPVVSERQRDRILGYIEAGTADGAKLVAGGSIPKDQPRGW
FVEPTVFADVDNAHRIAQEEIFGPVLAVIPYDGDEDAIALANDSEYGLGGTVWTTDRERA
MSIARQVHTGTIGINGYTLDIAAPFGGVKASGLGRELGPEGLAAFRSVKSIYGTGPS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaccccgatcaccgggcaggtctacatcggcggccagttccggcccagcgccgaggtc
accccggtgctcgaggccgcgaccggcacacccctgggcgacggtgccaacgccgggacc
gccgacgtcgacgacgcggtgtccgcggcgcgggccgccctgccgggctggcgcgccacc
ccggccgcccgacgcgccgagatcctggtggcgttggccgaggccctgaaggcgcgcgcg
tcgagcaccaacgaactggtgacccgcgagaacggcatgccgatgtcgctgtcgcgcggc
gtcaacggggccttcccggcggtgctgctcaactactacgcggccctgatcaccgcgctg
cccgaggaggaggtgcgctccgggcccaccgggcataccacggtccggcacgagccggtg
ggcgtggtcggggccatcaccccgtggaactacccgcaggcgctggcggcgttcaagctg
gccccggcgctggctgcgggctgtccggtggtgctcaagccctcgcccgagaccgccttg
gacgccatggttttcggcgaggccgccaccgaggccgggctgccgcccggcgtgctgaac
atcgtccccggtggcaccgagaccggcgtgcacctggtggcgcacccgggcgtggacaag
gtgtcctttaccggttccaccgtcgccggccgcgccatcggcgaggtgtgtggccgcctg
ctgcgcccggtgaccctcgagttgggcggcaagtcggcggccatcatcctcgacgacgcc
gacctggacgccacgctggccggtctgcgcacgcagtcgttcaccaacaacgggcagacc
tgctacctgaactcccgcgtgctggccccgcgctcgcgctacgccgagatcgtcgaggcg
ctggcggaactggcgggcagcctgcgggtcggcgacccgctggacccgagcaccgagatc
ggccccgtggtcagcgagcgccagcgcgaccgcatcctcggctacatcgaggccggcacc
gccgacggcgccaaactggttgccggaggctcgatcccgaaggatcagccccgcggctgg
ttcgtcgaaccgaccgtcttcgccgacgtcgacaacgcgcatcgcattgcccaggaggag
atcttcggccccgtcctggcggtgatcccctacgacggtgacgaggacgcgatcgccctg
gccaacgacagcgagtacggcctgggcgggacggtgtggaccaccgaccgcgagcgcgcg
atgagcatcgcccgacaggtgcacaccggcaccatcggcatcaacggctacaccctggac
atcgccgccccgttcggcggcgtcaaggccagcggcctgggccgcgaactgggccccgag
ggcctggccgccttccgcagcgtgaagtcgatctacggcaccggcccgtcctga

KEGG   Mycolicibacterium chitae: MCHIJ_41190
Entry
MCHIJ_41190       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_41190
   00053 Ascorbate and aldarate metabolism
    MCHIJ_41190
   00620 Pyruvate metabolism
    MCHIJ_41190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_41190
   00561 Glycerolipid metabolism
    MCHIJ_41190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_41190
   00310 Lysine degradation
    MCHIJ_41190
   00330 Arginine and proline metabolism
    MCHIJ_41190
   00340 Histidine metabolism
    MCHIJ_41190
   00380 Tryptophan metabolism
    MCHIJ_41190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_41190
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_41190
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_41190
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_41190
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_41190
SSDB
Motif
Pfam: Aldedh Glyco_hydro_125
Other DBs
NCBI-ProteinID: BBZ04682
Position
complement(4323553..4325028)
AA seq 491 aa
MTVTEPITESRGFWIDGTWAAPSGAQRIEINNASTGAAVATVPAAERPDVDAAVAAARRA
FDESDWATRGAAARAAAITSLATALLARSNETAAAVSTQNGMPISIASATEAVMPATLLN
YYANLAAEQPAEERRSAFGGGTTVVRREPIGVVAAIVPWNFPQTLTFFKLAPLLAAGCTV
VVKPSPETVLDSYLLAEAIAESDIPAGVINIVPGGREVGAYLVEHPGVDKVAFTGSTAAG
RAIGEACGRLIRPVTLELGGKSAAIVLDDADLPSLLSQFFTATLMNNGQTCYLGTRVLAP
QARYRETVDLLTDFARALNVGDALDPATQIGPLATANQQRRVQDYIAKGVADGGRVTTGG
DRPDGLDAGWFVAPTIFDNVDNSHTIAREEIFGPVLAVIPYGDVDDAVAIANDSDFGLGG
SVWTGDQDRGLAVARRVQTGSIGVNDYALDLHAPFGGVKASGLGRELGPEGLAAYQQVKS
IFLPAKEVAPQ
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaccgtcaccgaaccgatcaccgaatcccggggcttctggatcgacggcacctgggcc
gcgccctcgggggcccaacgcatcgagatcaacaacgcgagcaccggggccgcggtcgcg
acggtcccggccgccgagcgccccgatgtggacgccgccgtcgccgcggcgcgccgcgcc
ttcgacgaatccgactgggccacccggggcgcggcggcgcgcgccgccgcgatcacctcg
ctggccaccgcgctgctggcccgctcgaacgaaaccgccgccgcggtcagcacgcagaac
ggcatgccgatctcgatcgcctcggccaccgaggccgtcatgccggcgacgttgctgaac
tactacgcgaacctcgccgccgaacagcccgccgaggagcggcggagcgccttcggcggg
ggcaccaccgtggtgcggcgcgaaccgatcggcgtggtcgcggcgatcgtgccgtggaac
ttcccccagacgttgaccttcttcaagctcgcgccgctgctggcggcgggttgcacggtg
gtggtcaaaccctcgccggagaccgtgctcgactcctatctgctcgccgaggccatcgcg
gagtccgacattccggccggggtgatcaacatcgtgcccggcggccgcgaggtcggcgct
tacctcgtcgagcaccccggtgtcgacaaggtcgcgttcaccggttccaccgccgcgggc
cgggccatcggggaggcctgcggccggttgatccggccggtgacgctggaactcggcggc
aaatcggccgcgatcgtcctcgacgacgccgacctgccgtcgctgctgtcgcagttcttc
accgcgaccctgatgaacaacggacagacctgctatctgggcacccgggtgctggccccc
caggcgcgctaccgcgaaaccgtggacctgctcaccgatttcgcccgtgccctcaacgtc
ggcgacgcgctggacccggccacccagatcgggccgctggcgaccgccaaccagcagcga
cgcgtgcaggactacatcgccaagggagtggccgacggcggccgcgtcaccaccggcggc
gaccggcccgacggtctggacgccggctggttcgtcgcgcccaccatcttcgacaacgtg
gacaactcccacaccatcgcccgggaggagatcttcggacccgtgctggccgtgatcccg
tacggcgacgtcgacgacgccgtggccatcgccaacgactccgacttcggcctgggtggc
agcgtgtggaccggggaccaggaccgcggcctcgcggtggctcgccgggtccagaccggc
agcatcggcgtcaacgattacgctctggatctgcacgccccgttcggcggcgtcaaggcc
agcggcctggggcgtgagctgggccccgagggcctggccgcctatcaacaggtcaagtcg
atcttcctgcccgcgaaagaggtagcgccgcaatga

KEGG   Mycolicibacterium chitae: MCHIJ_50540
Entry
MCHIJ_50540       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_50540
   00053 Ascorbate and aldarate metabolism
    MCHIJ_50540
   00620 Pyruvate metabolism
    MCHIJ_50540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_50540
   00561 Glycerolipid metabolism
    MCHIJ_50540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_50540
   00310 Lysine degradation
    MCHIJ_50540
   00330 Arginine and proline metabolism
    MCHIJ_50540
   00340 Histidine metabolism
    MCHIJ_50540
   00380 Tryptophan metabolism
    MCHIJ_50540
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_50540
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_50540
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_50540
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_50540
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_50540
SSDB
Motif
Pfam: Aldedh SDH_C
Other DBs
NCBI-ProteinID: BBZ05617
Position
5252860..5254407
AA seq 515 aa
MSTVKFPALTLPDIADLRDRARAALRSVGADPVLGDLDAPGLPASTPITGEILFRVAEST
PADAEAAIAQAAQAFTVWRSTPAPVRGALVGRLGELLTEHKSALADLVTIEVGKIGSEAL
GEVQEMIDVCQFAVGLSRQLYGKTIASERPGHRLMETWHPLGVVGVITAFNFPVAVWAWN
TAVALVCGDTVVWKPSELTPLTAIACQALLARAAAEVGAPAEVSRLLLGGRDLGEVLVDD
PRVALLSATGSVRMGREVGPRVARRFGRSLLELGGNNAAVVTPAADLDLAVRGIVFAAAG
TAGQRCTTLRRLIAHRSVADTLVERIATAYRSLPVGDPFSSDTLVGPLIHETAYRSMVGA
LEQAAADGGEVLGGERHASPEACYYVSPALVRMPAQTAVVHDETFAPLLYVLTYDTLDEA
IALNNAVPQGLSSAIFTTDVREAERFLAADGSDCGIANVNIGTSGAEIGGAFGGEKQTGG
GRESGSDSWKAYMRRATNTVNYSSELPLAQGVQFG
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtccaccgtgaaattccccgccctcaccctccccgacatcgccgacctgcgcgaccgg
gcccgcgccgcactgcgctccgtcggcgccgacccggtcctcggcgatctcgacgcgccg
ggcctgccggcgagcaccccgatcaccggcgagatcctgttccgggtggccgagtccaca
cccgcggacgccgaggccgcgatagcccaagcggcgcaggccttcaccgtctggcgcagc
acgccggccccggtccgcggcgcgctggtgggccggctcggcgagttgctcaccgagcac
aagagcgcgctggccgacctggtgaccatcgaggtcggcaagatcggctccgaggcgctc
ggcgaggtccaggagatgatcgacgtctgtcagttcgcggtgggactgtcccggcagctc
tacggcaagaccatcgcctccgagcgccccggccaccgcctgatggagacctggcatccg
ctgggcgtcgtcggggtcatcacggccttcaacttcccggtggcggtgtgggcctggaac
accgcggtggccctggtctgcggcgacaccgtggtctggaaaccctccgaactgacgccc
ctgaccgccatcgcctgccaggccctgctcgcgcgcgccgccgccgaggtcggcgccccc
gcggaggtcagtcggctcctgctgggtggtcgcgacctcggcgaggtcctcgtcgacgac
ccgcgcgtcgcgctgctcagcgccaccggatcggtgcggatgggccgcgaggtcggcccg
cgcgtggcgcggcgcttcgggcgctccctgctcgaactcggcggcaacaacgccgcggtg
gtgaccccggcggcggatctggatctcgcggtgcgcggcatcgtgttcgccgcggccggc
accgcgggtcaacggtgcaccacgctgcgccgcttgatcgcgcaccggtcggtggccgac
accttggtcgaacgcatcgccaccgcgtatcgcagtctgccggtgggtgatccgttctcg
tcggacacgttggtggggccgctgatccacgagacggcctaccggtccatggtgggcgcg
ctggaacaggccgccgccgacggcggtgaggtgctcggcggggagcggcacgcctccccc
gaggcgtgctactacgtctcgcccgcgctggtgcggatgcccgcgcagaccgcggtggtg
cacgacgagacgttcgccccgctgctgtacgtgctgacctacgacaccttggacgaggcg
atcgcgctgaacaacgcggtgccccagggcctctcctcggcgatcttcaccaccgacgtc
cgcgaggccgagcggttcctggccgccgacggctccgactgcggcatcgccaacgtcaac
atcggcacctcgggcgccgagatcggcggggccttcggcggcgagaagcagaccggcggc
gggcgggaatccggatccgattcgtggaaggcctacatgcgccgcgccaccaacaccgtg
aactactcctcggaactccccctggcccaaggtgtgcagttcggctag

KEGG   Mycolicibacterium chitae: MCHIJ_50760
Entry
MCHIJ_50760       CDS       T06603                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_50760
   00053 Ascorbate and aldarate metabolism
    MCHIJ_50760
   00620 Pyruvate metabolism
    MCHIJ_50760
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_50760
   00561 Glycerolipid metabolism
    MCHIJ_50760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_50760
   00310 Lysine degradation
    MCHIJ_50760
   00330 Arginine and proline metabolism
    MCHIJ_50760
   00340 Histidine metabolism
    MCHIJ_50760
   00380 Tryptophan metabolism
    MCHIJ_50760
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_50760
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_50760
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_50760
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_50760
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_50760
SSDB
Motif
Pfam: Aldedh DUF756
Other DBs
NCBI-ProteinID: BBZ05639
Position
complement(5280290..5281735)
AA seq 481 aa
MTDRENFFIGGGWVAPVSSGVVAEVGEAATGSVLGRSPLAGTADIDAAVTAARGALEAWG
AQPAADRAAAMRRLGAALKSRAKDTAKLVSRENGMPAKLSIGANGYSPALMLDYYADLCE
SLDRDDLRSGMLAQVRVRRDPVGVVAAIIPWNYPQALAAMKIAPALAAGCTVVLKAAPET
ALDAFVWADAALEAELPAGVLNIVPGGRDAGTHLVSHPDVNKVAFTGSTAAGRAIGEACG
RLLRPVTLELGGKSAALVAADADLDVFLAGLLDVCLPNNGQTCHAGTRILAPRARYDEVV
DAVTETVRGLRVGDPLDRATQIGPLVSEAQRKRVLGYIDEGRRSGARLTTGGSVPADQSV
GWFVEPTVFADVDNASVIAREEIFGPVLCVLPYADEEEAVAIANDSDYGLGGTVWTTDVE
RGQQLADRIQSGSVGVNHYALDVVGPFGGVKASGLGRELGPEGLAPYQVLKSVYLPPAGT
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgacggaccgcgagaacttcttcatcggcggcggctgggtggctccggtgtcgtccggg
gtggtcgccgaagtcggcgaggccgcaaccggttcggtgttggggcgctcgccgctggcc
ggcaccgccgacatcgacgcggcagtgacggcggcgcggggcgcgctggaagcatggggt
gcgcaaccggcagcggaccgggccgccgcgatgcgtcgcctcggggccgcgctgaagagc
cgggccaaggacacagccaagctcgtcagtcgcgagaatgggatgcccgcgaagctgtcg
atcggtgcgaacggctacagcccggcactcatgctcgactactacgccgatctctgtgaa
agcctggaccgcgacgacctgcgctcgggaatgctcgcgcaggtacgggtgcgcagggac
cccgtcggcgtggtcgcagcgatcattccgtggaactacccgcaggcactggccgcgatg
aagatcgcccccgcactggcggctggatgcacggtcgtattgaaagccgctccggagacg
gcgctcgacgcgttcgtctgggccgacgcggccctggaggccgaactaccggccggggta
ctgaacatcgttcccggtggccgggacgcgggtacgcacctggtcagccatcccgacgtc
aacaaggtcgcgttcacgggttcgacggcggccggacgcgcgatcggcgaggcgtgcggt
cggctgctgcgacccgtcacgttggaactcggcggcaagtccgccgcgctggtcgccgcc
gacgctgacctcgacgtatttctcgccgggttgctggacgtgtgcctgcccaacaacggt
cagacctgtcacgccggtacgcgcatcctcgcgccccgggcgcggtacgacgaagtggtc
gatgcggtcaccgaaaccgtgcgtgggctgcgggtgggtgaccctctcgatcgcgccacc
cagatcggcccactggtcagcgaggcgcagcgcaagcgcgtgctcggctacatcgatgag
ggccgacgcagcggcgcccgcctgaccaccggcggttcggtccccgccgatcaatcggtc
ggctggttcgtcgaaccgaccgtgttcgccgacgtggacaacgccagtgtgatcgcccgg
gaggagatcttcgggccggtgctgtgtgtactgccgtatgccgatgaggaggaggccgtt
gcgatcgccaacgactcggactacggcctcggcggcacggtgtggaccaccgacgtcgag
cggggacagcagctggcggaccgcatccagagcggctcggtgggcgtcaaccactacgcc
ctcgacgtggtcggcccgttcggtggcgtgaaggccagcgggttgggccgtgagctcgga
cccgagggtctggcgccctaccaggtcctcaagtcggtttatctgccgccggccggaacc
gcttga

KEGG   Mycolicibacterium chitae: MCHIJ_50770
Entry
MCHIJ_50770       CDS       T06603                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00010  Glycolysis / Gluconeogenesis
mcht00053  Ascorbate and aldarate metabolism
mcht00071  Fatty acid degradation
mcht00280  Valine, leucine and isoleucine degradation
mcht00310  Lysine degradation
mcht00330  Arginine and proline metabolism
mcht00340  Histidine metabolism
mcht00380  Tryptophan metabolism
mcht00410  beta-Alanine metabolism
mcht00561  Glycerolipid metabolism
mcht00620  Pyruvate metabolism
mcht00625  Chloroalkane and chloroalkene degradation
mcht00770  Pantothenate and CoA biosynthesis
mcht00903  Limonene and pinene degradation
mcht01100  Metabolic pathways
mcht01110  Biosynthesis of secondary metabolites
mcht01120  Microbial metabolism in diverse environments
mcht01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCHIJ_50770
   00053 Ascorbate and aldarate metabolism
    MCHIJ_50770
   00620 Pyruvate metabolism
    MCHIJ_50770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCHIJ_50770
   00561 Glycerolipid metabolism
    MCHIJ_50770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCHIJ_50770
   00310 Lysine degradation
    MCHIJ_50770
   00330 Arginine and proline metabolism
    MCHIJ_50770
   00340 Histidine metabolism
    MCHIJ_50770
   00380 Tryptophan metabolism
    MCHIJ_50770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCHIJ_50770
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MCHIJ_50770
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_50770
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCHIJ_50770
Enzymes [BR:mcht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MCHIJ_50770
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBZ05640
Position
complement(5281735..5283186)
AA seq 483 aa
MTNREELLIDGQWRKPKSTERLSVISASTEEVIGSVSDAGGEDVDAAVTAARRSFDEGTW
RRLGVDERAEILERALQILEPKLDEVANVVTSEMGLPTSIAQVQIPSALGTARFFIDVAK
NEPIAELRPGQTTAAVVKEPVGVVASIAPWNGPFNMAVNKITAPLVAGCSVVFKPAAETP
LDVFYYAEALAEAGVPAGVFNLITGHRDTGRALVNHPGVDKVSFTGSTVAGREIGEVCGR
SFKRMQLELGGKSAAIILEDADIPTTMQGLAVGSFFNTGQVCAAYSRVLVPRTRYDEIVD
ALVATAESFVVGDPFDPATTMGPLVSQQQRERVEGYISIGVDEGAKILTGGGRPAGLDRG
WFVQPTVFGSADNSMRICQEEIFGPVTTVMTYDNLEEAIAIANDSDYGLHGAVFTADDEA
ALRVAQAVRTGTFSVNSFNYNTEAPFGGVKCSGVGRDTGREGLTAYYELKTINLTPGMER
LFS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaccaaccgcgaggaactgctgatcgacggtcaatggcgcaagccgaagagcaccgaa
cggctttcggtgatcagcgcttccaccgaagaagtgatcggatcggtgtccgacgccggc
ggcgaggacgtcgacgccgccgtcaccgcggcgcgccggtcgttcgacgaagggacctgg
cggcgactgggcgtcgacgagcgtgctgagatcctcgagcgcgcgttgcagatcctcgag
ccgaaactcgatgaggtcgccaacgtggtgacctcggagatgggattgcccacttccatt
gcccaagttcagattccgagtgctctcggtaccgcccgcttcttcatcgacgtagccaag
aacgaaccgatcgccgaactgcgtccgggccagacgaccgccgcagtggtcaaggaaccg
gtcggtgtggtcgcctcgatcgccccgtggaacgggccgttcaacatggcggtcaacaag
atcaccgcgcccttggtggcgggatgcagcgtcgtcttcaagccggcggcggagacgccg
ctggatgtcttctactacgccgaggcgctcgccgaggcgggcgtgcccgctggggtgttc
aatctgatcaccggccaccgcgacaccggccgcgccctggtcaatcacccgggggtggac
aaggtcagcttcaccggttcgaccgtggccggccgcgagatcggcgaggtctgtgggcgc
agcttcaagcgcatgcagctggagctcggtgggaagtcggccgcgatcatcctcgaagac
gccgacatcccgaccaccatgcagggcctggcggtgggctccttcttcaacaccggccag
gtctgtgccgcctacagccgcgttctcgtcccgcggacccgctatgacgagatcgtcgat
gctctggtcgccaccgcggagtcgttcgtcgtgggggaccccttcgacccggcaacgacc
atggggcccttggtgtctcagcaacagcgcgagcgggtggagggctacatctcgatcggt
gtggacgagggcgcgaagatcctcaccggcggcggccggcccgcggggctggaccggggc
tggttcgtccaaccgaccgtgttcggatcggcggacaactccatgcgcatctgccaggag
gagatcttcggaccggtcaccaccgtgatgacctacgacaatctcgaagaggccatcgcg
atcgccaacgattcggactacggattgcacggcgcggtgttcactgccgacgacgaagcc
gcactgcgggtggcccaggccgttcgcacgggcacgttcagcgtgaacagcttcaactac
aacaccgaggcgccgttcggcggggtgaagtgttccggtgtcgggcgtgacaccggccgt
gagggcctgaccgcctactacgagctcaagacgatcaacctcacaccgggaatggaaagg
ctgttcagctga

DBGET integrated database retrieval system