KEGG   Mycolicibacterium chitae: MCHIJ_10520
Entry
MCHIJ_10520       CDS       T06603                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_10520
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MCHIJ_10520
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL_3 SnoaL DUF4440 SnoaL_4 WI12 DUF1348
Other DBs
NCBI-ProteinID: BBZ01615
Position
1071645..1072001
AA seq 118 aa
MSAEEVVRAEIAAWGRNDVDEVMSHFADDATFFIGPEYPELAGRDAIQQIMKAFFARGKC
VDLEIRHLAVTGNVVLMERFDHWIVEGKQKSWPVMGAYEVRDGKITAWREYFFTPPED
NT seq 357 nt   +upstreamnt  +downstreamnt
atgagtgccgaggaagtagtgcgcgccgagatcgccgcgtggggccgcaatgacgtcgac
gaggtcatgagccatttcgcggacgatgccacgtttttcatcgggcccgaatatccggaa
ctggccggccgcgacgcgatccagcagatcatgaaggcgttcttcgcccgcggaaagtgc
gtggacctcgagatccgccatctggccgtcaccgggaacgtggtgctgatggagcggttc
gatcactggatcgtcgagggcaagcagaagagctggccggtcatgggcgcctacgaggtg
agggacggcaagatcacggcctggcgcgaatactttttcaccccgccggaggactga

KEGG   Mycolicibacterium chitae: MCHIJ_44090
Entry
MCHIJ_44090       CDS       T06603                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mcht  Mycolicibacterium chitae
Pathway
mcht00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mcht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCHIJ_44090
Enzymes [BR:mcht01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MCHIJ_44090
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL WI12 DUF4440 SnoaL_3
Other DBs
NCBI-ProteinID: BBZ04972
Position
4614408..4614860
AA seq 150 aa
MTEQTNGLVGHTTAESDIAIVDKFFSALRDKDLDTAESLLDNDVVYQNVGLPTIHGSRRA
MRLFTGMQRPSLGFDLKIHRTAADGGTVLNERTDVITVGPVRMQFWVCGVFEVRDGRITL
WRDYFDFYDMTKGLLRGLLGAIVPGLRPTL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgacggagcagaccaacggtctcgtaggccacaccaccgccgaatccgacatcgccatc
gtggacaaattcttctccgcgctgcgcgacaaggacctcgacaccgccgagtcgctgctg
gacaacgacgtggtctatcagaacgtcggcctgccgacgatccacggcagccggcgcgcc
atgaggctgttcaccgggatgcagcgccccagcctgggcttcgacctgaagatccaccgg
acggccgccgacggcggcaccgtgctcaacgagcgcaccgacgtcatcaccgtcggcccg
gtccgcatgcagttctgggtgtgcggggtcttcgaggtccgcgacgggcggatcacgctg
tggcgcgactacttcgacttctacgacatgaccaagggtttgctgcgcggcctgctgggc
gcgatcgtcccagggttgcgcccgacgctgtga

DBGET integrated database retrieval system