KEGG   Mesorhizobium ciceri: Mesci_0055Help
Entry
Mesci_0055        CDS       T01401                                 

Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
mci  Mesorhizobium ciceri
Pathway
mci03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mesci_0055
DNA repair and recombination proteins [BR:mci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Mesci_0055
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mesci_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim PHF5 HHH_5
Motif
Other DBs
NCBI-GeneID: 10115494
NCBI-ProteinID: YP_004139279
UniProt: E8TMS4
Position
complement(58755..59360)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLSPLAAAMAEAADKVRIC
STCGNVDTSDPCMICTDPRRDAGTIIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGI
GPEQLNMRSLVDRVAGGEVKEIILAVNATVEGQTTAHYLTDQLSGFDIKVTRLAHGVPVG
GELDYLDEGTLAAALRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcgaatcgccggtcccgagatcgaacgtctgatccagctcctggccaaggtg
ccggggctgggaccccgttcggccaggcgtgccgcccttcatctgatcaagaagaaagag
cagcttttgtcgccccttgccgccgccatggccgaggcggccgacaaggtgcgcatctgc
tcgacctgcggcaatgtcgatacatcggacccttgcatgatctgcaccgatccgcgccgt
gatgccggcaccatcatcgtcgtcgaggacgtctccgacctgtgggcgctggagcgcgcg
gcggcgatgaatgtgcgctaccacgtgctcggcggcacgctgtcgccgctcgacggcatc
ggccccgagcaactcaacatgcgctcgctggttgatcgcgtcgccggcggcgaggtcaag
gagatcatcctcgccgtcaatgcgacggtggagggccagacgaccgcgcattacctcacc
gaccagttgtccggcttcgacatcaaggtgacgcgccttgcgcatggcgtgccggtaggc
ggcgaactcgactatctcgacgagggcacgctggccgcggcgctgcgttcgcggacggcg
ttttga

DBGET integrated database retrieval system