KEGG   Mesorhizobium ciceri: Mesci_0451Help
Entry
Mesci_0451        CDS       T01401                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00260  Glycine, serine and threonine metabolism
mci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01130  Biosynthesis of antibiotics
mci01230  Biosynthesis of amino acids
Module
mci_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_0451
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesci_0451
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesci_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 10115893
NCBI-ProteinID: YP_004139673
UniProt: E8TBE0
Position
492955..493794
Genome map
AA seq 279 aa AA seqDB search
MATRIDRRMAKLRNEGRPALVTYFMGGDPDYDTSLSIMKALPGAGSDIIELGMPFSDPMA
DGPAIQAAGLRALKGGQTLAKTLKMAADFRAGDNETPIVLMGYYNPIYIYGVDRFLKDAI
ASGIDGLIVVDLPPEMDEELCIPALKAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSM
TGITGSALADTGKVAAAVKRIKGHTDLPVCVGFGVKTAEQARVIGANADGVVVGTAIVNA
VANVLGPKGEKTADPAEAVATLVSGLAQGVRSARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccacccgcatcgaccgccgcatggcgaagctcaggaacgaaggccgcccggcgctc
gtcacctatttcatgggcggcgaccccgactacgacacctctttgtcgatcatgaaggcg
ttgccgggcgcaggttccgatattatcgagctcggcatgccgttttccgatccgatggcc
gacggcccggcgatccaggcggcgggcttgcgggcgctgaaaggcggccagacgctggcc
aagacgctgaagatggcggccgacttccgcgccggcgacaatgaaacgccgatcgtgctg
atgggctactacaatccgatctacatctatggcgtcgaccgcttcctcaaggacgcgatc
gccagcggcatcgacgggctgattgtcgtcgacctgcccccggagatggatgaggaactg
tgcattccggcattgaaagccggcatcaacttcatccggctggcgacgccgaccaccgac
gacaaacgcctgcccaaggtgctgcagaacacgtcgggcttcgtctattacgtgtcgatg
accggcatcaccggctcggcgctggccgacaccggcaaggtggcggcggcggtcaagcgc
atcaagggccacaccgacctgccggtctgcgtcggcttcggcgtcaagaccgccgagcag
gcccgggtgatcggcgccaatgccgacggcgtcgtcgtcggcaccgcgatcgtcaatgcg
gtggccaatgtgctggggccgaagggcgagaagaccgccgatccggccgaggccgtcgcc
acgctggtcagcgggcttgcgcaaggcgtgcgctcggcccgccttgctgctgccgaatag

DBGET integrated database retrieval system