KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0470Help
Entry
Mesci_0470        CDS       T01401                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00020  Citrate cycle (TCA cycle)
mci00620  Pyruvate metabolism
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_0470
   00020 Citrate cycle (TCA cycle)
    Mesci_0470
   00620 Pyruvate metabolism
    Mesci_0470
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_0470
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Mesci_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-GeneID: 10115912
NCBI-ProteinID: YP_004139692
UniProt: E8TBF9
Position
515322..516932
Genome map
AA seq 536 aa AA seqDB search
MSEVGKRNSACAIDHIGLKTTGVVRYNFGAAALYEDSIRRGEARLTAHGALVAETGQHTG
RSPKDKFVVRNSDTEPHVWWDNNKAISQAQFDTLLADFQAHAADKDLYVQDLIGGADAEL
KLPTRVVTEFAWHSLFIRNLLIRPDAAELDHFVPDMTIIDLPSFRADPTRHGSRTETVIA
VDLTRKIVLIGGTSYAGEMKKSVFTMLNYLLPAKGVMPMHCSANEGMAGDAAIFFGLSGT
GKTTLSADPSRTLIGDDEHGWGPHGIFNFEGGCYAKTIKLSAEAEPEIFATTQRFGTVLE
NVVLDADGVPDFNDGRLTENTRCAYPLDFIPNASKTGRANHPKNIIMLTADAFGVMPPIA
RLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRELIARH
GADCWLVNTGWTGGAYGTGKRMPIKATRALLAAALDGSLKTAEFRTDPHFGFEVPVAVRG
VDSAILDPRSTWADKAGYDRQAARLVGMFAINFEKFESHVDAVVLGAAPRMQEAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagtcggcaaacgcaattccgcctgcgcgatcgatcatatcggcctgaaaacc
accggcgtggtgcgctataatttcggtgcggctgccctttatgaggactcgatccggcgc
ggcgaagcccgcttgacggcacatggcgcgctggtcgccgaaacaggccagcacaccggc
cgctcgcccaaggacaagtttgtcgtccgcaacagtgacaccgaaccgcacgtctggtgg
gacaacaacaaggcaatttcacaagcccagttcgacacgctgctcgccgatttccaggcg
catgccgcggacaaggatctatacgtccaggacctgatcggcggcgccgatgcggagctg
aagctgccgaccagggtggtcaccgaatttgcctggcactcgctgttcatccgcaatctg
ctcattcgtcccgatgccgccgagctcgatcatttcgtgcctgatatgacgatcatcgac
ctgccgtccttccgcgccgatcccacccgccacggcagccgcaccgaaacggtgatcgcc
gtggatctcacgcgcaagatcgtgctgatcggcggcacctcctatgccggcgagatgaag
aagtcggtgttcaccatgctcaactatctgctgccggcgaaaggcgtgatgccgatgcat
tgctcggccaacgagggtatggccggcgacgccgccatcttcttcggcctgtcgggcacc
ggcaagacgacactctcggccgatccctcgcgcacgctgatcggcgacgacgagcatggc
tggggaccccacggcatcttcaatttcgaaggcggctgctacgccaagacgatcaagctg
tcggcggaagccgagccggaaatcttcgccaccacgcagcgcttcggcacggtgctggaa
aatgtcgtgctcgacgctgatggcgtgccggatttcaacgacggaaggctgaccgaaaac
acacgctgcgcctacccgctggatttcatccccaacgccagcaagaccggccgcgccaac
catccgaagaacatcatcatgctgaccgccgacgcgttcggcgtgatgccgccgatcgcg
cggctgaccccggcgcaggcgatgtatcatttcctctccggctacaccgccaaggtggcc
ggaaccgaaaagggcgtgaccgagccggaagcgacgttttcgacctgtttcggcgcaccg
ttcatgccgcgccatccatcggaatacggcaatctgctgcgcgagctgattgcccgccac
ggcgccgattgctggctggtcaacaccggctggaccggcggcgcctacggcaccggcaag
cgcatgccgatcaaggcgacgcgggccttgcttgccgccgcactcgacggctcgctcaag
acggccgagttccgcaccgaccctcatttcggtttcgaggtgccggtggcggttcgaggc
gtcgacagcgccattctcgacccgcgctccacctgggccgacaaggccggctatgaccgg
caggcggcaaggctggtcggcatgttcgccattaatttcgagaaattcgaaagccatgtc
gatgccgtggtgctgggtgcggcgccgcgcatgcaggaagccgcggagtaa

DBGET integrated database retrieval system