KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_0618Help
Entry
Mesci_0618        CDS       T01401                                 

Definition
(RefSeq) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00360  Phenylalanine metabolism
mci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mci00790  Folate biosynthesis
mci01100  Metabolic pathways
mci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mesci_0618
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesci_0618
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesci_0618
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Mesci_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 10116061
NCBI-ProteinID: YP_004139840
UniProt: E8TDL1
Position
complement(654399..655235)
Genome map
AA seq 278 aa AA seqDB search
MTTMSVAEYARDCAAQGLRGDYSVCRADFTVSQGYDYSDEEQAVWRTLCDRQTRLTRKLA
HHSYLDGVEKLGLLDRIPDFDEVSAKLRKLTGWEIVAVPGLIPAAPFFDHLADRRFPVTN
WLRTRQELDYIVEPDMFHDFFGHVPALSQPVFADFMQMYGEKAGDIIALGGDEMISRLYW
YTAEYGLMQEAGQPLKAFGAGLMSSFTELQFAVEGKDAHHVPFDLETVMRTGYEIDKFQR
AYFVLPSFDALRDAFQTADFAAIVARRKDQPALDPATL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgagcgttgccgaatacgcccgcgactgcgcggcgcaaggattgcgcggc
gactactcggtctgccgtgccgatttcaccgtgtcgcagggttacgattacagcgatgaa
gagcaggcggtgtggcgcacgctgtgcgaccgccagaccagactgacgcgcaagctcgcc
caccattcctacctcgacggcgtcgaaaaactcggcctgctcgaccgtattcccgacttc
gacgaggtcagcgccaagctgcgcaaactgaccggttgggagatcgtcgcggtgccgggg
ctcattcccgcggctccgtttttcgaccatctcgccgatcgccgcttcccggtcaccaac
tggctgcggaccaggcaggagctcgactacattgtcgagcccgacatgttccatgatttc
ttcggccatgtgccggcgctgtcgcaaccggtgttcgccgatttcatgcagatgtatggc
gagaaggccggcgacatcatcgcgctgggtggcgacgagatgatttcccggctctactgg
tacacggccgaatatggcctgatgcaggaggccggccagccgctgaaggcctttggcgcc
ggccttatgtcgtcgtttaccgagctgcagttcgcggtcgaaggcaaggacgcccaccac
gtgcccttcgacctggaaacggtgatgcgcaccggctacgagatcgacaagttccagcgc
gcctatttcgtgctgccgtccttcgacgccttgcgcgatgccttccagaccgccgatttc
gcggcaatcgtcgcccggcgcaaggaccagccggcgctcgacccggcgacgctctag

DBGET integrated database retrieval system