KEGG   Mesorhizobium ciceri: Mesci_1059Help
Entry
Mesci_1059        CDS       T01401                                 

Definition
(RefSeq) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00520  Amino sugar and nucleotide sugar metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_1059
   00520 Amino sugar and nucleotide sugar metabolism
    Mesci_1059
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mesci_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 10116505
NCBI-ProteinID: YP_004140273
UniProt: E8TJW6
Position
complement(1101922..1102641)
Genome map
AA seq 239 aa AA seqDB search
MAKAVKQPASGTETPDAEKIVLTIDIGGSHVKILTSAGGAERRADSGPGLTPQQMIDTVK
KLAEGLSYDVVSMGYPGPVNHNRPLADPANLGKGWAGFDFAGAFGKPVKVVNDALMQAIG
SYEGGRMLFLGLGTGLGAAMIADNVAQPMELAHLPYKKGKSFEDYVGERGLEKRGKKKWR
KYVFDVVDRLRAAMQPDYVVIGGGNVDKLDELPADSRRGDNTRAFEGGFRLWRDKALIV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcagtgaagcaaccagcatcgggcaccgagacgccagatgctgaaaagatc
gtgctcacgatcgacatcggcggctcgcacgtcaagatcctcaccagcgccggcggcgcg
gagcgccgcgccgattcggggccggggctgacgccgcaacagatgatcgataccgtgaag
aagctcgccgaaggcctgtcctacgacgtcgtctcgatgggctatcccggtccggtcaac
cacaacaggccgctcgccgaccccgccaatctcggcaagggctgggctggattcgacttt
gcgggcgcgttcggcaaaccggtgaaagtggtcaatgacgcgctgatgcaggccatcggc
agctacgagggcgggcgcatgctgttcctcgggctcggcaccgggctcggtgcggcgatg
attgccgacaacgtcgcccaaccgatggaactcgcgcatctgccctacaagaagggcaag
agcttcgaggattatgtcggcgaacgcggcctggaaaagcgcggcaagaagaaatggcgc
aaatacgtcttcgacgtcgtcgaccggctccgtgccgccatgcagcctgactatgtcgtc
attggcggcggcaacgtcgacaagctcgatgaattgcccgccgactccaggcgcggcgac
aacacacgcgccttcgaaggcgggtttcgtttgtggcgcgacaaagcgctgatagtctga

DBGET integrated database retrieval system