KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_1329Help
Entry
Mesci_1329        CDS       T01401                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00071  Fatty acid degradation
mci00072  Synthesis and degradation of ketone bodies
mci00280  Valine, leucine and isoleucine degradation
mci00310  Lysine degradation
mci00362  Benzoate degradation
mci00380  Tryptophan metabolism
mci00620  Pyruvate metabolism
mci00630  Glyoxylate and dicarboxylate metabolism
mci00640  Propanoate metabolism
mci00650  Butanoate metabolism
mci00900  Terpenoid backbone biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
mci01212  Fatty acid metabolism
mci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesci_1329
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_1329
   00640 Propanoate metabolism
    Mesci_1329
   00650 Butanoate metabolism
    Mesci_1329
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mesci_1329
   00072 Synthesis and degradation of ketone bodies
    Mesci_1329
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesci_1329
   00310 Lysine degradation
    Mesci_1329
   00380 Tryptophan metabolism
    Mesci_1329
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesci_1329
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesci_1329
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mesci_1329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mci04147]
    Mesci_1329
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mesci_1329
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FliC
Motif
Other DBs
NCBI-GeneID: 10116778
NCBI-ProteinID: YP_004140539
UniProt: E8TN46
Position
complement(1388539..1389717)
Genome map
AA seq 392 aa AA seqDB search
MSASIVIASAARTPVGSFNGAFAATPAHELGAVVIRELLSRAGVEPGEVDEVILGQVLTA
AQGQNPARQASINAGLPKETTAWGLNQVCGSGLRAIALGMQQIAIGDARVIIAGGQESMS
LSTHAQHLRAGVKMGDFKLIDTMIKDGLWDAFNGYHMGNTAENVARQFQITREDQDQFAL
ASQNKAEAAQKAGKFKDEIVAVTIKGKKGDTIVDQDEYIRHGATIDAMTKLKPAFDKDGT
VTAANASGINDGAAGALLMSEAEAVRRGITPLARIVSWATAGVDPQIMGTGPIPASRKAL
EKAGWSVGDLDLVEANEAFAAQACAVNKDMGWDPSIVNVNGGAIAIGHPIGASGARVFNT
LVFEMRRRGAKKGLATLCIGGGMGVAMCVEAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccatcgtcattgccagtgcggcgcgcacgccggtcgggtccttcaacggc
gccttcgccgccaccccggcgcatgagctcggggccgtcgtcatcagggaattgctgtca
cgcgccggcgtcgaaccaggcgaggtcgacgaggtcatcctcggccaggtgctgaccgcc
gcgcaaggccagaacccggcccgccaggcatcgatcaatgccggcctgcccaaggaaacc
accgcctggggcctcaatcaggtttgcggctcgggcctgcgcgccatcgcgctcggcatg
cagcagatcgccatcggcgatgccagggtgatcatcgccggaggccaggaatcgatgtcg
ctttcgacgcatgcccagcacctgcgcgccggcgtcaagatgggcgacttcaagctgatc
gacaccatgatcaaggacgggctgtgggacgccttcaacggttaccacatgggcaacaca
gccgaaaacgtcgcgcgtcagttccagatcacccgcgaagaccaggaccagttcgcgctc
gcctcgcaaaacaaggccgaggccgcgcagaaggccggcaagttcaaggacgagatcgtc
gccgtcaccatcaagggcaagaagggcgacaccatcgtcgaccaggacgaatacatccgc
cacggcgccacgatcgacgccatgaccaagctgaaaccggctttcgacaaggacggcacg
gtgaccgccgccaacgcctccggcatcaatgacggcgccgccggcgcgctgctgatgagc
gaagcggaagcggtgaggcgcggcatcaccccgctggcgcgcatcgtgtcctgggcaacc
gccggcgtcgatccgcagatcatgggcaccggacccattcccgcctcgcgcaaggccttg
gaaaaggccggctggtcggtcggcgatctcgacctggtcgaggccaacgaagcctttgcg
gcgcaggcctgcgccgtcaacaaggacatgggctgggatccctcgatcgtcaacgtcaat
ggcggcgccatcgccatcggccacccgatcggtgcgtccggcgctcgcgtcttcaacacg
ctggtcttcgaaatgcgccggcgcggcgccaagaagggtctcgctaccctgtgcatcggc
ggcggcatgggcgtcgccatgtgtgtcgaagcactctga

DBGET integrated database retrieval system