KEGG   Mesorhizobium ciceri: Mesci_2115Help
Entry
Mesci_2115        CDS       T01401                                 

Definition
(RefSeq) cytochrome C class I
  KO
K08738  cytochrome c
Organism
mci  Mesorhizobium ciceri
Pathway
mci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mci00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesci_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 10117582
NCBI-ProteinID: YP_004141317
UniProt: E8TI09
Position
complement(2227991..2228380)
Genome map
AA seq 129 aa AA seqDB search
MLRAASFASILLLASSLVAHAGGDPALGKKVFNRCMACHDAATDRDKVGPHLLGVVGRTA
GSAESFLGHYSEAMKSAGAAGLVWDEANLAEYLKAPKLKVPSNKMAFGGLTNDDDIANVI
AYLKADPKP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagccgcttcgttcgccagtatccttctccttgccagctcgctcgtagcccat
gccggcggcgatcctgccctgggcaagaaggtcttcaaccgatgcatggcctgccatgac
gcagccaccgaccgcgacaaggtcggtccgcatctgttgggcgtcgttggccgcactgcc
ggcagcgccgagagctttcttggccactattccgaggcgatgaagagtgccggcgccgcc
ggcctggtctgggatgaagccaatctcgccgagtatctcaaggccccaaagctgaaggtg
ccgagcaacaagatggccttcggcggcctgaccaatgacgacgacatcgccaatgtcatc
gcctatctgaaggccgatcccaagccctga

DBGET integrated database retrieval system