KEGG   Mesorhizobium ciceri: Mesci_2416Help
Entry
Mesci_2416        CDS       T01401                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00630  Glyoxylate and dicarboxylate metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01200  Carbon metabolism
Module
mci_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_2416
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mesci_2416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 10117886
NCBI-ProteinID: YP_004141612
UniProt: E8TM63
Position
complement(2528157..2529446)
Genome map
AA seq 429 aa AA seqDB search
MTDFYNLVPSAPEGRFDGIERPYSAADVKRLRGSVQIRQSLAEMGANRLWKLIHEEDFVN
ALGAMSGNQAMQQVRAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAAPELVKRINRT
LQRADQIETSEGNGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVVARTDAEAAKLLTSDVDERDQ
PFVDYDAGRTIEGFYHVRNGIEPCIARAIAYAPYADLIWCETSKPDLAQARKFADGVRKH
HPDKLLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHQLNYGMFELARG
YKARQMAAYSELQEAEFAAEADGYTATKHQREVGTGYFDAVSMAITGGQSSTTAMHESTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaacctcgtcccatcggcgccggaaggtcgcttcgacggtatcgaa
cgaccctactcggcggcggatgtgaagcgtctgcgcggttcggtgcagatccgccagagc
cttgccgaaatgggcgccaatcggctgtggaagctcatccacgaggaggacttcgtcaac
gcgctcggcgccatgtccggcaatcaggcgatgcagcaggtgcgcgccgggctgaaggcg
atctacctgtcgggctggcaggttgccgccgacgccaacacggctggcgcgatgtatccg
gaccagtcgctctacccggccaatgcggcgcctgaactggtcaagcgcatcaaccggacg
ctgcagcgcgccgaccagatcgagacctccgaaggcaatgggctttcggtcgaaacctgg
ttcgcgccgatcgttgccgacgccgaagccggcttcggcgggccgctcaacgccttcgaa
atcatgaaagccttcatcgaggcgggcgccgccggcgtccactatgaggaccagttggcg
tcggaaaagaaatgcggccatctcggcggcaaggtgctgatcccgactgcggcgcacatc
cgcaacctcaacgccgcgcgcctggcggcggacgtgatgggcacgccgaccctggtcgtc
gcgcgcaccgatgcggaagccgccaagctgctcacctccgacgtcgacgagcgcgaccag
cctttcgtcgactacgacgccgggcgcacgattgagggtttctatcatgtcaggaacggc
atcgagccctgcattgcccgcgccatcgcctatgcgccttacgcggatctgatctggtgc
gagacctcgaagccggacctggcacaggccaggaaattcgccgacggcgtgcgcaagcac
catcccgacaagctgctcgcctacaattgctcgccgtcgttcaactggaagaagaacctc
gacgacgcgacgattgccaagttccagaaggagctcggcgccatgggctacaagttccag
ttcatcacgctcgccggctttcaccagctcaactacggcatgttcgaattggcgcgcggc
tacaaggcgcggcagatggcggcctattccgagttgcaggaagcggagttcgcggccgag
gccgatggctacaccgcgaccaagcatcagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgatggcgatcaccggcggccagtcgtcgaccaccgccatgcatgaatcgacggag
cacgcgcagttcaaaccggccgccgaatag

DBGET integrated database retrieval system