KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_2665Help
Entry
Mesci_2665        CDS       T01401                                 

Definition
(RefSeq) alcohol dehydrogenase GroES domain-containing protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesci_2665
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mesci_2665
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mesci_2665
    1.1.1.-  
     Mesci_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Sacchrp_dh_NADP Shikimate_DH ApbA ADH_zinc_N_2 FAD_binding_3 TrkA_N
Motif
Other DBs
NCBI-GeneID: 10118136
NCBI-ProteinID: YP_004141850
UniProt: E8T8M8
Position
2798017..2799039
Genome map
AA seq 340 aa AA seqDB search
MKAARLYGPGDLRVEDIATPGAPDAGWVKLRVDAAGICGSDLHNFRTGQWISRSPSTAGH
ELTGTVTATGAGVDAFAIGDRVVADSRFWCGDCAQCQAGRHHLCASLGFVGEVCDGGFAE
QAVLPARLLHIIDAGLDERVAAMAEPLAVALHAVRRLPKTTGFVLVVGCGPIGGLAALLL
SRTFAGTVLIADRNQSRCARVARVTGARIVDLSRDAVAAATANAPLLAAIEATGSVAALN
QMLGVLDPGGTIAMVGIFHGRLDIDPNTLVEREIGLLGCHAFAGELPEAVRMLGELSEPL
LALIDQEIGLDDIPAAYERLLAGRSDGLKTIIRMRQPVES
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcacgactttacgggcccggcgatctgcgcgtcgaagacatcgcgacgccg
ggcgcgccggatgcaggctgggtgaagctcagggtcgatgccgccggcatctgcggttcg
gacctgcataatttccgcacgggacagtggataagccggtcgccttcgacggccggccat
gaactcaccggcacggtgaccgccaccggcgcgggcgtcgacgccttcgctatcggtgac
agggttgtcgccgattcccgcttctggtgcggagactgcgcgcaatgccaagccggcagg
catcatctctgcgcgtcactgggcttcgtcggagaggtctgcgacggcggttttgccgaa
caggcggtgctgcccgcacggcttttgcatatcatcgatgccgggctcgacgagcgggtc
gcggcaatggccgagccgctggcggtggcgctgcacgcggtgcggcgcctgccgaaaacg
acaggattcgtgctggtcgtcggctgcgggcctatcggcggtcttgccgccctgctgttg
tcgcggaccttcgccggcaccgtgctgatcgccgaccgcaaccagagccgctgcgcccgg
gtggcgcgggtgacgggtgcccggatcgtcgatctgagccgggacgccgttgccgccgca
actgccaatgccccgctgctcgcggccatcgaggcgaccggcagcgtcgcggcgctcaat
cagatgctcggcgttctcgatcccggcggtacgatcgccatggtcggcatcttccacggc
cgcctcgacattgatcccaatacgctggtcgaacgcgaaatcgggttgctgggatgccat
gcctttgccggcgaactgcccgaggccgtgcggatgctgggtgaattgagcgaaccgctg
ctggcgctgatcgaccaggagatcggcctggatgacattccggctgcctatgagcggctg
ttggcggggcgcagcgacggcttgaaaacaatcatccgcatgcggcaacctgtcgagtcg
tga

DBGET integrated database retrieval system