KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3148Help
Entry
Mesci_3148        CDS       T01401                                 

Definition
(RefSeq) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00471  D-Glutamine and D-glutamate metabolism
mci00550  Peptidoglycan biosynthesis
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mesci_3148
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesci_3148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mci01011]
    Mesci_3148
Enzymes [BR:mci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Mesci_3148
Peptidoglycan biosynthesis and degradation proteins [BR:mci01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesci_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 10118622
NCBI-ProteinID: YP_004142322
UniProt: E8TF52
Position
3284831..3286231
Genome map
AA seq 466 aa AA seqDB search
MIPAASFSGKRVSLFGLGGSGIATARALIEGGADVLAWDDNPDSVAKAAIAGIATADLRG
ADWAKFSAFVLSPGVPLTHPKPHWTVELARGSGVEIVGDIELFCRERMLSAPTAPFIAIT
GTNGKSTTTALTAHILKAAGRDAQMGGNIGRAVMTLDPPEPDRHYVVECSSYQIDLAPSI
NPTAGILLNLTPDHLDRHGTMQHYAAIKERLVAGSETAIVGIDDSWCAQIAERLERAGRH
VIRISKRLPLTDGYFADGSNLMEAVHGRYSRVAFLEGIGSLRGQHNAQNALAAVAACLKI
GLELGEIQSGLESFPGLAHRMEQVGRKDHVLFINDSKATNADAAAPALSSFARIYWIAGG
LPKEGGIEPLRGFFPRIAKAYLIGEAAPAFSATLGEAVPYEISGTLAAAVEHAAHDAAKD
DSGEAVVLLSPACASFDQFKNFEVRGEAFRQAANAIEGVKPIGGAR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttgatccccgccgcatccttttcaggcaagcgcgtttcgctcttcgggcttggtggctcg
gggatcgcgacggcgcgcgcgctgatcgagggcggcgcggacgtgctggcctgggacgac
aatcccgacagtgtggccaaggccgccattgccggtatcgcgaccgctgatttgcgcggc
gccgactgggcgaaattctcggccttcgtgctgtcgcctggtgtgccgctgacgcatccc
aagccgcattggacggtggaactggcgcgcggctcaggcgtcgagatcgtcggcgacatc
gagcttttctgccgcgagcggatgctgagcgcgccgacagcgcctttcatcgccatcacc
ggcaccaacggcaagtcgacgacgaccgcgctgaccgcgcacatcctgaaagccgcggga
cgcgatgcccagatgggcggcaatatcggccgcgcggtgatgacgctcgatccgcccgag
cccgatcggcactatgtcgtcgagtgttcgtcctaccagatcgacctcgcgccctcgatc
aatccgacggccggcatcctgctcaatctgacgcccgatcatctcgaccgccatggcacc
atgcagcactacgccgcgatcaaggagcggctggtggccggcagcgagacggcgatcgtc
ggcatcgacgattcctggtgcgcgcagattgccgagcggctggagcgggcggggcggcat
gtcatccgcatttccaagcgcctgccgctgaccgacggctatttcgccgatggcagcaat
ttgatggaagctgtgcacggccgttacagccgtgtcgccttcctcgaaggcatcggctcc
ttgcgtggccagcacaatgcccagaacgctctggctgcggtcgccgcttgtctcaagatc
gggctggagcttggtgaaatccagtcgggactggaaagctttcccggcctcgcgcaccgc
atggagcaggtcggccgcaaggaccatgtgctgttcatcaacgattccaaggcgaccaat
gccgatgctgcggcgccggcgctgtccagcttcgcgcgcatctactggatcgccggcggc
ctgcccaaggaaggcggcatcgaacccttgcgcggcttcttcccgcgcatcgccaaggcc
tatcttatcggcgaggcggcgccggcgttttcggcgacgctgggcgaggccgtgccctac
gagatttcaggcacgctggccgcggcggtcgagcacgccgcgcatgatgcggctaaggac
gacagcggcgaggcggtggtgctgctgtcgccggcctgcgccagcttcgaccagttcaag
aatttcgaagttcgcggcgaagccttcaggcaagctgcgaatgctatcgagggtgtgaaa
cccatcggaggggcacgataa

DBGET integrated database retrieval system