KEGG   Mesorhizobium ciceri: Mesci_3563Help
Entry
Mesci_3563        CDS       T01401                                 

Definition
(RefSeq) glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00220  Arginine biosynthesis
mci00250  Alanine, aspartate and glutamate metabolism
mci00471  D-Glutamine and D-glutamate metabolism
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesci_3563
   00220 Arginine biosynthesis
    Mesci_3563
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mesci_3563
Enzymes [BR:mci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mesci_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11 PT-TG Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 10119045
NCBI-ProteinID: YP_004142733
UniProt: E8TLD2
Position
3715477..3716424
Genome map
AA seq 315 aa AA seqDB search
MPELEQAPKLDRALAEVAAEMAERTDRGDVASYIPQLGKVDPKKFGIAAVTNDGRVLMAG
DADQAFSIQSISKVFTLTLALGNVGDALWQRVGREPSGNPFNSIVQLEHENGIPRNPFIN
AGAIVISDILLAGHQPREAIGEILRFIQFLADDETIIIDREVAASERATGYRNFALANYM
KSFGNLHHAPELALGVYFHHCAIAMSCRQLALAGRFLANGGKNPATGHSVVSAERARRIG
AMMLTCGHYDGSGDFAFRVGIPGKSGVGGGILGIVPGVASLAVWSPGLNANGNSKLGSIA
LEKLARMMNWSIFAP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttgaacaggcccccaaacttgatcgggcattggccgaagtcgccgccgaa
atggccgagcgcaccgatcgcggcgacgtcgcttcctacattccgcagctgggcaaggtc
gatccgaagaagttcggcatcgcggcggtcaccaatgacggccgcgtgctgatggccggc
gatgccgaccaggcattttccatccagagcatctcgaaagtgtttacgctgacactggcg
ctcggcaatgtcggtgacgcgctttggcagcgggtaggccgcgaaccgtcaggcaatcca
ttcaactcgatcgtgcagctcgagcatgagaacggcattccgcgcaacccgttcatcaat
gccggcgccattgtcatttccgacatcctgcttgccggccaccagccgcgcgaggcgatc
ggcgaaatcctgcgcttcatccagttcctcgccgacgacgaaacgatcatcatcgatcgt
gaggtcgcggcgtccgaacgggccaccggctatcgcaacttcgcgcttgccaactacatg
aaatccttcggcaatctccaccacgcgccggagctggcgctgggcgtctacttccaccat
tgcgccatcgcaatgagttgccggcaactggcgctcgccggccgcttcctcgccaatggc
ggcaagaacccggcgaccgggcattccgtggtgtcggccgaacgggcacgccgcatcggc
gcgatgatgctgacctgcggtcactatgatggctccggcgatttcgccttccgcgtcggc
atccccggcaagagcggcgtcggcggcggcatattgggcatcgtgccgggcgtggcgtcg
cttgccgtctggtcgcccggcctcaatgccaacggcaactccaagctggggtcgatcgcg
ctggaaaagctggccaggatgatgaactggtcgatcttcgcgccgtga

DBGET integrated database retrieval system