KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3734Help
Entry
Mesci_3734        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3606 HNH_4
Motif
Other DBs
NCBI-GeneID: 10119220
NCBI-ProteinID: YP_004142903
UniProt: E8TNH1
Position
complement(3883625..3883810)
Genome map
AA seq 61 aa AA seqDB search
MKDKSGDIDHTLPQVAIDDQQVRQLAATTDLPSRQARELVRRHGNDPRKLEELARSINAT
N
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaagtcaggagatatcgaccatacattgccgcaggtcgccatcgacgatcag
caggtgcgacagctggccgccacgaccgatttgccgtcaaggcaggcacgcgaactggtg
cgccgtcacggcaacgatccccgcaagctggaagagttggcgaggtcgatcaacgccacc
aactga

DBGET integrated database retrieval system