KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3735Help
Entry
Mesci_3735        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119221
NCBI-ProteinID: YP_004142904
UniProt: E8TNH2
Position
3884008..3884166
Genome map
AA seq 52 aa AA seqDB search
MPQPRQPDPNRDMPVPPPTWKPEPIEEPEPETLPDETPLPNPDENEEPPVHA
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgccacagccaagacagccagacccaaatcgcgatatgcccgtgccgcctccaacatgg
aagccggagccgatcgaggaacccgaaccggaaacgcttccggacgagactccgctgccc
aaccccgacgagaatgaagagcctcccgtccacgcatga

DBGET integrated database retrieval system