KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3736Help
Entry
Mesci_3736        CDS       T01401                                 

Definition
(RefSeq) NADH dehydrogenase I subunit D
  KO
K00333  NADH-quinone oxidoreductase subunit D [EC:1.6.5.3]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00190  Oxidative phosphorylation
mci01100  Metabolic pathways
Module
mci_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mesci_3736
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Mesci_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Motif
Other DBs
NCBI-GeneID: 10119222
NCBI-ProteinID: YP_004142905
UniProt: E8TNH3
Position
complement(3884213..3885403)
Genome map
AA seq 396 aa AA seqDB search
MVEAAVRNFTINFGPQHPSAHGVLRLVLELDGEIVERADPHIGLLHRGTEKLIEHKNYLQ
ALPYFDRLDYVAPMNQEHAFCLAAEKLLDITVPKRGQLVRVLFCEIGRLLSHLLNVTTQA
MDIGALTPPLWGFAEREKLMVFYERASGARMHANYFRIGGVHQDLPAKLLDDIWAFCDPF
LKVCDNLDDLLTGSRIFKQRNVDVGVIGLDDAWRWGFSGVMVRGSGAAWDLRKAQPYECY
PDMDFDIPVGKNGDCYDRYLVRMEEMRQSVRIMKQCLEKLRSPEGQGPVAIPNQKITPPR
RATMKRSMEATIQHFKLYTEGHRVPAGEVYAAVEAPKGEFGVYLVSDGGNVPYRCKIRAP
SFAHLQAMDFLSRGHMIADVAAIIGSLDIVFGEIDR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagccgccgttcgcaacttcaccatcaatttcgggccacagcatccctccgcc
catggtgttcttcggttggtgctcgaactggacggcgagatcgtcgagcgtgccgatccg
catattggcttgctccatcgaggcaccgaaaaactcatagagcacaagaactatttgcaa
gcgctgccctatttcgatcggctcgactatgtcgcgccgatgaaccaggagcatgcgttc
tgcctcgccgccgaaaaactgctcgacataacagttccaaagcgtgggcagcttgtccgt
gttcttttttgcgaaattggccggcttctgtcgcatctcctcaatgtcacgacccaggcc
atggatatcggcgccctgacgccgccgctttggggatttgcggagcgcgagaagctgatg
gtcttttacgagcgcgcctccggcgctcgcatgcatgcgaattacttcagaatcggcggc
gtgcaccaggatttgcctgcgaagcttctcgacgacatctgggctttctgcgatccgttc
ctcaaagtctgtgacaacctcgacgatctgctcaccggcagccgcatcttcaagcagcgc
aatgtcgatgttggtgtgatcgggctggatgatgcctggcgctgggggttttccggcgtg
atggtacgcggatcgggcgcggcatgggatttgcgcaaggcacagccatacgaatgttac
cctgacatggatttcgacatccccgtcggcaagaacggagactgctatgaccgttatctc
gtccgtatggaggagatgcgccagtcggtgcggatcatgaagcaatgcctggaaaaactg
cggtcacccgaaggccaggggccggtcgcgattccgaaccagaagatcacgccgccgcgg
cgcgccacgatgaaacgctctatggaagcgaccatccagcatttcaaactttataccgag
gggcatcgcgtgccggcgggagaagtctacgccgcggttgaagcgccaaagggagaattc
ggcgtttatctggtttctgacgggggcaacgtcccttaccggtgcaaaatacgtgcgcca
tctttcgcccatctgcaggcgatggatttcctgtctcgagggcacatgatcgccgacgtt
gccgcgatcatcgggtcgctcgacatcgtgtttggcgagatagatcgttag

DBGET integrated database retrieval system