KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3738Help
Entry
Mesci_3738        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hom_end
Motif
Other DBs
NCBI-GeneID: 10119224
NCBI-ProteinID: YP_004142907
UniProt: E8TNH5
Position
3886106..3886333
Genome map
AA seq 75 aa AA seqDB search
MSIARWAIRPVGTAKAFLAEELRSARYGDIVSVKAAIEAARRDAPYLQDTDDELMETIIE
LARELGLAVLFDSRD
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgccagatgggcaataagacctgtcggtaccgccaaggcgtttctggcagaa
gagcttcgaagtgcgcgatacggcgacatcgtttcggtcaaagcggcgatagaggccgct
cgcagggacgcgccttatttgcaggatacagatgatgaattgatggagacgatcatcgag
ctggcacgggaactgggtctggccgtcctttttgactctcgcgattga

DBGET integrated database retrieval system