KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3743Help
Entry
Mesci_3743        CDS       T01401                                 

Definition
(RefSeq) PEBP family protein
  KO
K06910  uncharacterized protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mesci_3743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-GeneID: 10119229
NCBI-ProteinID: YP_004142912
UniProt: E8TNI0
Position
complement(3889556..3890026)
Genome map
AA seq 156 aa AA seqDB search
MPLALSSAAFAEGGPIPERYTRDGKNVSPPLKWSGVPDDAKSLVLVVQDPDAPSGTFGHW
AVFNISAETRELPEAESGKPGPGALRQATNDFGNAYYDGPEPPVGHGVHHYHFRLAALDT
PSLAIPASAGVERIWREAQKHSLEQAELIGTYERNP
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgccacttgccctcagcagcgccgcctttgccgaaggcggaccaattcccgaaagatat
acacgagacggcaaaaacgtatcgccgccgctgaaatggtctggagtaccggacgacgcc
aaaagcctcgttctcgtcgttcaggatcctgatgcgccgagcggaacgtttggtcattgg
gcggtattcaacatctccgcggagacaagggaacttcccgaggcggaaagcggcaagcca
ggtcccggtgcccttaggcaagcaacaaatgattttggcaacgcctattacgacggccct
gaacccccggtcggacatggcgtccaccattaccatttccggctggccgcgctcgacacg
ccgagccttgccattccggccagcgcaggcgtcgagcgcatctggcgggaggcgcagaaa
cactcgctcgagcaggcagaactcatcggaacctacgaacgcaatccgtaa

DBGET integrated database retrieval system