KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3744Help
Entry
Mesci_3744        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119230
NCBI-ProteinID: YP_004142913
UniProt: E8TNI1
Position
complement(3890074..3890280)
Genome map
AA seq 68 aa AA seqDB search
MTGTKHPKWKKPSDADLANNPGIGTSKGTIKEGEEFELEGENTVEGDVENDTTAAGGIDP
RQKMRTNK
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaccaaacatccgaaatggaaaaaaccgagcgatgccgacttggcgaacaat
cctggtatcgggacttccaagggaacgatcaaggaaggcgaagagttcgagcttgaaggc
gagaacacggtcgaaggtgatgtcgagaacgacacgaccgctgctggcgggatcgatcca
agacaaaagatgcggaccaacaaatag

DBGET integrated database retrieval system