KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3745Help
Entry
Mesci_3745        CDS       T01401                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Erythro_esteras PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_18 GCD14 Cofac_haem_bdg Methyltransf_23 DREV Methyltransf_24 MTS CMAS Methyltransf_3 ACP_syn_III_C Fibrillarin Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 10119231
NCBI-ProteinID: YP_004142914
UniProt: E8TNI2
Position
complement(3890379..3892370)
Genome map
AA seq 663 aa AA seqDB search
MLDLPRARDRMVNIHVGRRGIHDREILQAMREVPREAFVEPGFEEFAYEDTPLPIADGQT
ISQPYIVAFMIEMADVKPGDHVLEIGTGSGYAAAVMSRIVEQVYTIERHPGLAETAKRRF
EKLGYRNIEVRTGDGTKGWPQAAPFDAIVVTASGPGAPLALQEQLDVGGRLVIPVGDDPD
LQRLLKVTRTGAATYSEEDFGGVRFVPLIGEQGWSENGTVTKVGRPLRHPHPISLPDMIA
AAAEPLPDFDDPAFGALFDRFADRRVVLLGEASHGTSEFYRARAAITRRLIERHGFTIVA
VEADWPDAAAIDRYVRHRRPRTGAGAPFQRFPTWMWRNTDVAAFSDWMRRRNEKLEPSEQ
AGFYGLDIYNMSGSIGAVLDYLDRVDPQAAKIARERYGCLTPWQHEPSTYGRAVLTAGYK
KCEKAVLEQCRDLLARQLDYAKQDGTDFLDASQNARLIASAEHYYRIMYYGGAESWNLRD
THMFETLEHLLDAGGPNSKAVVWAHNSHIGDARFTEMGVVRDELNIGQLCRQRFGDEAAL
VGMGTHSGTVAAASDWDGEMEVKQVRASHADSYERLCHDSLVSRFLLDLGRDKTLRERLL
ERRLERFIGVIYRPETELGSHYADASLPQQFDAFLWFDKTAAVTPLGPEHARTGVPDTYP
FGL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcttcctcgtgcccgtgatcgaatggtcaatatccacgtcggccggcgtggc
atccatgaccgtgaaattctgcaggcgatgcgcgaagttccacgcgaggccttcgtagaa
cccggtttcgaggaatttgcttatgaagacacgccgctgccgatcgccgacggccagacc
atatcgcaaccctacatcgtcgcattcatgatcgaaatggcggacgtcaaaccgggtgac
cacgtgctcgaaatcggcaccggctcgggttacgccgccgcggtgatgagccggatcgtc
gaacaggtctacaccatagagcgtcatcccggtttggcagaaacggcgaaacggcggttt
gaaaaactcggctatcgaaacatcgaggtccggacaggcgatggcaccaagggctggccg
caggcggcgccgttcgatgccatcgtggtgacagccagcggtcccggcgcaccgctcgcc
cttcaggagcaactcgatgtcggcggcaggctcgtcattccggtcggcgacgaccccgat
ctgcaacgcctgctcaaagtcacccggacaggtgccgcaacctacagcgaggaggatttc
ggcggcgtgcgcttcgtccctctcatcggcgagcagggttggtcggaaaacggcaccgtc
accaaggtcggtcgtccacttcgacatccgcatccgatcagcctgcccgatatgatcgcg
gccgcggctgaaccgctgcccgatttcgacgatccggccttcggcgcattgttcgatcgg
ttcgccgaccggcgcgtcgttctgcttggcgaggcaagccatggcacgtccgagttctac
agggcgcgcgcggcgatcacccgcaggcttatcgaacggcacggcttcaccatcgtcgcg
gtcgaggcggactggcccgatgcggcggcgatcgaccgctacgttcgccatcgtcggccg
cgaacaggcgccggtgcgccattccagcggtttccgacgtggatgtggcgcaacaccgat
gtcgcggccttctccgactggatgcgccgtcgcaacgagaagctagaaccttcggagcaa
gcagggttctacggcctggacatctacaatatgagcgggtccataggcgcggtcctcgac
tatctcgaccgggtcgatccccaggcagccaagatcgcacgcgaacggtatggttgcctg
acgccctggcaacacgaaccgtctacctacggccgtgcggtgctcaccgccggctataaa
aaatgcgagaaagccgtgctggaacaatgccgggacttgctcgccagacaactcgattat
gcaaaacaggacggaaccgactttctcgacgccagtcagaatgcccggctgatcgcgtcc
gccgaacactactaccggatcatgtactatggcggtgcggagtcctggaacctgcgcgac
acccatatgttcgagaccttggaacatttgttggacgccggcggccccaactccaaggcg
gtggtgtgggcgcacaattcccatatcggcgatgcccgctttaccgagatgggtgtcgtc
agggacgaactgaacatcggtcagctctgccggcagcgtttcggcgatgaggcagcgcta
gtcggtatgggcacgcattccggcactgtagcggccgcaagcgactgggatggcgaaatg
gaggtgaagcaggttcgcgcgtcgcacgccgacagctacgaacggctttgccacgattct
ctcgtgtcgcggttcctgctcgacctcgggcgcgacaagacgctgcgtgagcggctgctg
gaacgcaggctggagcgattcatcggggtaatctaccggccggaaaccgagctgggcagc
cactatgcggacgcttccctgccccagcagttcgacgcgttcctatggttcgacaaaacc
gcggcagtgacgccgcttggcccggagcatgcaagaaccggcgttcccgacacctatcca
ttcgggctctaa

DBGET integrated database retrieval system