KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3746Help
Entry
Mesci_3746        CDS       T01401                                 

Definition
(RefSeq) phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00030  Pentose phosphate pathway
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesci_3746
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_3746
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mesci_3746
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Mesci_3746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 10119232
NCBI-ProteinID: YP_004142915
UniProt: E8TNI3
Position
3892635..3895046
Genome map
AA seq 803 aa AA seqDB search
MNDKAATTPQAIGHERIDLMDRYWRAANYISVGQIYLLDNPLLREPLKAEHVKPRLLGHW
GTTPGLNFLYLHLNRVIRERDLDVLFICGPGHGGPAMVANTWLEGTYSEIYPDIGQGEDG
LRKLFRQFSFPGGVPSHAAPETPGSIHEGGELGYALVHAFGAAFDNPGLVVACVVGDGEA
ETGPLAAAWHSNKFLNPASDGAVLPILHLNGYKIANPTILGRMDDQELRDLFAGYGYEPF
FVEGHEPLAMHRSMAATLDTVLDRIRSIQEQARAPGWHGQRPKWPMIVLRSPKGWTGPKE
VDGDKVEGFWRSHQVPVSNARGNEEHRKILENWMRSYEPGELFDESGHLLPELAALAPTG
TRRMGASPYANGGLLKRDLMLPDWKSLALEVPRPGGVIAEATRICGSYLREVFRLNAEAR
NFRLMGPDETSSNRLDDVFEVTDRIWMERIEPYDVHLSRDGRVMEVLSEHLCQGWLEGYL
LTGRHGLFSCYEAFIHIVDSMVNQHAKWLKTSGELAWRKPIASLNYLLTSHVWRQDHNGF
SHQDPGFADLVANKKADTVRLYFPPDANTLLWITDHCLRTYNRINVITAGKQPGPQWLSI
EEAGAHCKAGAGIWEWAGTVAQHEEPDVVMACAGDVPTLETLAATDILRSAIPDLKIRVV
NVVDLMTLQSNTEHPHGLPDGDFDALFTKTRPVIFAYHGYPYLIHRLTYRRANHDNMHVH
GFREEGTTTTPFDMVVLNELDRYHLALAAIERVPGLAERAEGLAGELHGRLAKHKAYVRE
HGEDMPEIQKWSWPDKAATKGRQ
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaaggctgccacgacgccgcaggctatcggccacgaacggatcgacctcatg
gaccgttactggcgcgccgcgaattacatctcggtcggccagatctatctgctcgacaat
ccgctgctgcgcgaaccgttgaaggccgagcacgtcaagcctcggttacttggccattgg
ggcacgacgccgggcctgaattttctctacctgcatctgaaccgcgttatccgcgaacgc
gacctcgatgttctgtttatctgcggcccgggccatggcggtcccgcaatggtcgccaac
acatggctcgagggcacctatagcgagatctatcccgatatcgggcagggcgaagacggc
ctcaggaaactgttccggcagttttcctttcccggtggcgtgccaagccatgccgcgccc
gagacgccaggctccatccatgagggcggcgaattgggatatgcattggttcatgccttc
ggtgcggccttcgacaatccgggtctggtggttgcctgcgtcgttggtgacggcgaagcc
gagaccggtccgctggcggcggcatggcattccaacaagttcctgaacccagcgtcggat
ggcgccgtcctgccgatcctgcatctaaacggctacaagatcgccaatccgacgatcctc
ggccgcatggacgatcaggaattgcgagaccttttcgccggctatggctacgaaccgttc
ttcgtcgaaggccacgagccgcttgccatgcaccggtccatggccgcgacgctcgacacg
gtgctcgatcgcatccgttccattcaggagcaggcacgggctccgggatggcatggtcaa
cgcccgaaatggccgatgatcgtgctgcgcagccccaagggatggaccgggccgaaggag
gtcgatggcgataaggtcgagggtttctggcgctcgcatcaagtgccggtatcgaacgct
cgagggaatgaggagcaccgcaagatcctcgaaaactggatgcgaagctacgaaccggga
gagctgttcgacgaaagcgggcacctgttgccggagcttgcggcacttgccccgacaggg
acaaggcgcatgggcgcaagcccgtacgcaaatggtggcctgctgaagcgcgatctgatg
cttccagattggaaaagcctggcgctggaagtgccgcgtccaggtggcgtcattgccgag
gcgacgcggatttgcggaagctatcttcgcgaggtgttccgcctcaatgccgaggcgcga
aacttccgcctgatggggccggacgagacatcctccaaccgcctcgacgacgtgttcgag
gtcaccgatcggatctggatggagcgcatcgagccctatgacgtccatctttcccgtgat
ggtcgcgtcatggaagtgctgagcgagcatctctgccagggctggcttgaaggctatctg
ctcaccggccgccatggcctgttttcatgctatgaggccttcattcatatcgtcgattcg
atggtcaaccagcatgccaaatggctgaagacctccggcgagctcgcttggcgcaagccg
atcgcctcgctcaattaccttttgacctcgcatgtctggcggcaggatcacaatggtttc
agccatcaggatccgggctttgccgatctggtcgccaacaagaaggccgacacggtaagg
ctctatttcccgccggacgccaacaccctgttgtggatcaccgatcattgcctgagaacc
tataaccgcatcaatgtcatcaccgccggcaagcagccgggaccgcaatggctgtccatt
gaagaagccggagcgcattgcaaagctggagcgggcatctgggaatgggccggcacggtt
gctcagcacgaggagcccgatgtggtcatggcctgcgccggggatgtgccgaccctggaa
acactggccgcgacagacattctgcgctccgcgatccccgacctgaaaatccgcgtcgtc
aatgttgtcgacctgatgacattgcagtcgaacacggagcatccgcacggcctgcccgac
ggggacttcgacgcgttgttcacgaaaacacggcccgtcatcttcgcctatcacggctat
ccctatctcattcatcgcctgacataccgccgcgccaaccatgacaacatgcatgtgcat
ggcttccgcgaggagggcaccacgacgacgccattcgacatggtggtgctcaatgaactc
gaccgctaccatctcgcgctcgccgccatcgaacgcgtgccgggactggccgaaagggcc
gaagggcttgccggcgaactccacggcaggttggcgaagcacaaggcctatgtgcgcgag
cacggcgaagacatgcccgaaatccagaaatggagctggcccgacaaagccgcgacaaag
gggcgccaatga

DBGET integrated database retrieval system