KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3750Help
Entry
Mesci_3750        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO_C
Motif
Other DBs
NCBI-GeneID: 10119236
NCBI-ProteinID: YP_004142919
UniProt: E8TNI7
Position
complement(3897030..3897194)
Genome map
AA seq 54 aa AA seqDB search
MTAKKQKTESKDKKALRLAETTDVSPKQAKELMQKHGKDNPKVEKEARNFKAEG
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaagaagcagaagaccgaaagcaaggacaagaaggcattgcgcttggcagag
accaccgacgtctcacccaagcaggccaaggagctcatgcaaaagcatggcaaggacaac
cccaaggtcgagaaggaagccagaaacttcaaggcggaaggatag

DBGET integrated database retrieval system