KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3752Help
Entry
Mesci_3752        CDS       T01401                                 

Definition
(RefSeq) glutathione-dependent formaldehyde-activating protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFA NOB1_Zn_bind
Motif
Other DBs
NCBI-GeneID: 10119238
NCBI-ProteinID: YP_004142921
UniProt: E8TNI9
Position
complement(3897640..3898074)
Genome map
AA seq 144 aa AA seqDB search
MRRETGACFCGGIAAALDGEPFWICYDHDDDCRRAIGSPLTIWVGYRPKQFQLLRGTPKA
FSQTPGVTRTFCPDCGSSIGYSDEGLPDEFYVTIGFFDNPEGFRPQAHAYWDLRLPWIEF
DDSLPRIDRYSRKRDPKFGNPRDR
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgaaaccggagcctgcttctgcggagggatcgccgcagccctggacggagag
cctttctggatatgctacgatcacgacgacgattgccgccgggccatcggaagtccgctg
acgatctgggttggttaccggccgaagcaatttcagctccttagagggacgccgaaggcc
ttttcccaaacgccaggcgtcacccgcacgttctgcccagactgtggaagctcgataggc
tatagcgacgaaggcctgccggacgagttctatgtgacgatcggcttctttgacaaccct
gaagggtttcggccgcaagcccatgcctattgggacctgaggctgccgtggatcgagttt
gatgacagcctgccacgcatcgaccgatattcaaggaagcgcgacccgaagttcggcaac
ccgcgcgaccggtag

DBGET integrated database retrieval system