KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3753Help
Entry
Mesci_3753        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC DUF2171
Motif
Other DBs
NCBI-GeneID: 10119239
NCBI-ProteinID: YP_004142922
UniProt: E8TNJ0
Position
complement(3898148..3898447)
Genome map
AA seq 99 aa AA seqDB search
MDHTNHVRLTSTELTPDILEDATIYDADDNKVGSVSHVHGSGAASQVVIDVGGFLGIGAK
PVAVPASQLEFMRDEDGDVHAVTNWTKDQLKSMPEHHDA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggatcacaccaaccacgtacgcctcacaagcaccgaactgacaccagacattctcgaa
gacgccacgatttacgacgcagacgacaacaaagtcggcagcgtttcgcatgtgcacggc
tcaggagccgccagtcaggtcgtcatcgatgtcggcggctttctcggcattggcgccaag
ccggtggccgttcccgcaagccagttggaattcatgcgcgatgaagacggcgacgttcac
gcggtgacgaactggaccaaggatcagctcaagagcatgcccgagcatcacgatgcatga

DBGET integrated database retrieval system