KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3754Help
Entry
Mesci_3754        CDS       T01401                                 

Definition
(RefSeq) cyclic nucleotide-binding protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Crp_2 cNMP_binding
Motif
Other DBs
NCBI-GeneID: 10119240
NCBI-ProteinID: YP_004142923
UniProt: E8TNJ1
Position
3899020..3899769
Genome map
AA seq 249 aa AA seqDB search
MDYQTLQAKSELLRRMSADDFARLRPHLASVFLELRAPLETAGQKIEAVYFLESGLASVV
ARTSPATEAEVGIIGFEGMTGSALVMGDDQANFDCYVQSTCEALRIEAAPFVEALEDSPT
LRSFLLRYVQYFHVQTSYTASINARQSLEVRLARWLLMCSDRTVGDRLMITHEFLSIMLG
VRRPGVTVGLQMIESYGYIRARRGEITIRDRDGLMTLARDSYGPPETQYRRLVGDLGSKH
PARQERPLV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggattaccagacactgcaagccaagagcgaattgcttcgccggatgagcgcggacgat
ttcgcgcggctacgtccgcatctggcgagtgtttttcttgagttgcgcgcgccgctggag
accgcggggcagaagatcgaagccgtctattttctggaaagcgggctggcctcggtagtg
gcgaggacttcgcctgcgaccgaagccgaagtcggaatcatcgggttcgaaggaatgacc
ggttcggccctggtcatgggggacgaccaggccaactttgattgttacgtccagtcgaca
tgcgaggctctccggatagaggctgcccccttcgtcgaagccctggaggacagccctaca
ttgcggtcgttcctgttgcgctatgtccaatatttccatgttcagacaagctatacggca
tcgatcaacgcgcggcagagcctggaagttcgactggcaagatggcttttgatgtgcagc
gaccgcactgtcggcgacaggcttatgataacccatgaatttctgtccatcatgcttggt
gtgaggcgtccgggggttaccgtcggcctccagatgatcgaaagttatggttatatccga
gcgcgccgcggagagattacgatccgcgatcgagacggtctcatgacgttggcgcgagat
tcttacggtccacccgaaacccagtaccgccggctggtcggagatttgggctcgaagcat
cccgcgaggcaggagcggcctctcgtttga

DBGET integrated database retrieval system