KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3755Help
Entry
Mesci_3755        CDS       T01401                                 

Definition
(RefSeq) 2OG-Fe(II) oxygenase
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2OG-FeII_Oxy_2
Motif
Other DBs
NCBI-GeneID: 10119241
NCBI-ProteinID: YP_004142924
UniProt: E8TNJ2
Position
3900124..3900777
Genome map
AA seq 217 aa AA seqDB search
MPGGLAFTILAGMATPKSKTLDSGSSGLQHDLFGAADDLPEGFFYQPELITAQEETELAR
HLEGLPFEAFDFHGHLANRRVVGFGLRYDYDRRQVVEAPPIPDFLLSLRDKIAALAGRPA
NAFAQVLINEYRPGAGIGWHRDKPHFEDVAGVSLLAPCSFRLRRKNGTKWDRRTIVVEPR
SAYLMTGPSRMEWEHSIPAVDLHRYSITLRTLRANSA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgccaggcgggctggccttcaccatcttagctgggatggcgacacccaaatcgaaaaca
ctcgactccggctcatccgggcttcagcacgatctctttggtgctgccgacgacctgccg
gaaggtttcttctatcagcccgagttgatcacggcgcaagaagaaacggaactcgcccgg
catctggaaggccttccgttcgaggcgttcgatttccatggccatctggcaaaccggcgc
gtcgtcggttttggcctgcgttacgactacgacagacgccaggtcgtcgaggcgccgccg
atccctgacttcctgctgtccctgcgcgacaagatcgcagcgttggcaggccggcccgcc
aacgccttcgcgcaagtgttgatcaacgaataccggcccggcgccggcatcggctggcat
cgagacaagcctcatttcgaagacgttgcgggtgtttcgttgctggcgccttgcagcttc
cggctccggcggaagaatggcaccaaatgggaccgccggaccatcgtcgtcgaaccaagg
tcggcgtatctcatgaccggaccatcgcgcatggaatgggagcacagcattccggcggtt
gacctgcaccgctactcgatcaccttgaggacattgcgcgccaactccgcatga

DBGET integrated database retrieval system