KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3756Help
Entry
Mesci_3756        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2231
Motif
Other DBs
NCBI-GeneID: 10119242
NCBI-ProteinID: YP_004142925
UniProt: E8TNJ3
Position
3900910..3901350
Genome map
AA seq 146 aa AA seqDB search
MARARSVLVAARRPFHKTPMAVANACFVGTLLTDVAYWRSAEIMWADFSAWLLLAGLVVG
VLAVLAALVDLSTGRLARQAGPAWPYLLGSLVVLVISLFNALVHSRDAWTSVVPTGLILS
AVAVIVILLLGLLGWSSGHTQVEVVE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgcccgatccgtgttggtggcagccaggcgtccgttccataaaacgccgatg
gcggtcgcaaacgcatgtttcgtcggcacattgctgaccgacgttgcctattggcgaagc
gctgaaataatgtgggcagatttttccgcctggctgctccttgccggcctggttgtaggc
gtgctcgcggtccttgcagcacttgtcgatttgtctaccggccgacttgcccgtcaagcc
gggcctgcatggccatatctccttggcagcctcgtcgtgctcgtcatatcgctcttcaac
gcactggtgcacagccgtgatgcctggacctcggtcgtgccgacggggctcatcctgtcc
gccgtcgccgtgatcgttatcctcttgctgggactgctgggatggagttccggccacact
caagtggaggtggtcgaatga

DBGET integrated database retrieval system