KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3760Help
Entry
Mesci_3760        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3309
Motif
Other DBs
NCBI-GeneID: 10119246
NCBI-ProteinID: YP_004142929
UniProt: E8TNJ7
Position
3904633..3904797
Genome map
AA seq 54 aa AA seqDB search
MGLGTILIIILIIALLGGFSGLGGGPFYGTGYYGGGGLGLLLLIVIILVVLGRL
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcggcacaattcttatcatcattctgattatcgcattgcttggcggctttagt
ggacttggcggcgggccattctacggcaccggctattacgggggcggcggcctcggtctt
ctgctgcttatagtcataatcctggtcgtgctcgggcgtctctag

DBGET integrated database retrieval system