KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3762Help
Entry
Mesci_3762        CDS       T01401                                 

Definition
(RefSeq) transmembrane protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1772
Motif
Other DBs
NCBI-GeneID: 10119248
NCBI-ProteinID: YP_004142931
UniProt: E8TNJ9
Position
3906013..3906465
Genome map
AA seq 150 aa AA seqDB search
MAIYSLRVVSFIFVALAFAPAAAHFFAMFNKMKLDGPNYLAAQRAYDGWSLFGIVVLGAL
LSTAALAILLYRASASFGLVVVAFLSIGATQFAFWTLTYPINQATRNWTVLPENWELLRR
QWEYSHAIAAGLNALALLVLFISALRPAVR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctatagtctgagagtggtcagcttcattttcgttgccctggctttcgctccg
gccgccgcgcatttcttcgctatgttcaacaagatgaagctcgacgggccaaactatctg
gctgcgcagcgcgcctatgatggatggagcctgttcggcatcgtggtgctgggagcattg
ctctccacggccgccctggcgatcctgctctatcgagcgagcgcatctttcggcttggtt
gttgtcgcctttctaagcatcggcgccacgcagtttgccttctggacgctgacctatcca
atcaatcaggcgacccggaactggactgtcctccctgaaaactgggagctgctgcggcgc
caatgggagtattcgcatgccatcgccgcaggcctcaacgccttggcgttgctggtgctt
ttcatatcggcgcttcgccctgcggtgcgttga

DBGET integrated database retrieval system