KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3764Help
Entry
Mesci_3764        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119250
NCBI-ProteinID: YP_004142933
UniProt: E8TNK1
Position
complement(3906804..3907061)
Genome map
AA seq 85 aa AA seqDB search
MRELPKDIDADVVIEISKLLDDSPLFVPVRVHELAARVRQRVKTGLPDLSIEELIVEMAS
VRQLAMAFDLPGSENVVQIPVRYRR
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaattgccgaaagacatcgacgccgatgtggtcatcgaaatcagcaagctgctg
gacgacagcccgcttttcgtcccggtgcgggttcatgaacttgcggccagggtgaggcag
agggtgaagaccggcctgccagacctttcgattgaagaactgatcgtggagatggcctcc
gtacgtcagctggccatggcctttgatctgcctggatcggagaatgtcgtgcaaatcccg
gtgcggtatcgccgctag

DBGET integrated database retrieval system