KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3769Help
Entry
Mesci_3769        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 BKACE
Motif
Other DBs
NCBI-GeneID: 10119255
NCBI-ProteinID: YP_004142938
UniProt: E8TNK6
Position
complement(3909287..3909706)
Genome map
AA seq 139 aa AA seqDB search
MSMFYRAAKIAEEVHAAQRDKTGRPYIEHCRRVVDAVETKDQKVVAYLHDVLEKGEGWDR
TRLEEAGFGPTIASAVDAMSRRDGEDYFAFVRRAASNPLALPVKRADLADNIWQARQAGA
STVRYEEALRILDEEFPRG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgttttaccgggcggccaagattgccgaagaggtccacgcggcacagcgcgac
aagaccgggcgaccttatatcgagcactgtcgccgtgtcgttgacgcggtcgaaaccaag
gatcagaaggtcgtcgcctatctccatgacgtcctggaaaagggcgaaggctgggaccgg
accagattggaagaggccggttttggcccgacgatcgcgtcggccgtcgacgccatgtcg
cgcagggacggcgaggattacttcgcgttcgtgcgacgagcggcatcgaatccattggcg
ctgccggtgaagcgcgcggatctggcggacaatatctggcaggcacgacaggccggggca
tcaaccgtcagatacgaggaggcactacgcatccttgatgaagagtttccacgcggttag

DBGET integrated database retrieval system