KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3780Help
Entry
Mesci_3780        CDS       T01401                                 

Definition
(RefSeq) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K11177  xanthine dehydrogenase YagR molybdenum-binding subunit [EC:1.17.1.4]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00230  Purine metabolism
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mesci_3780
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Mesci_3780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Motif
Other DBs
NCBI-GeneID: 10119266
NCBI-ProteinID: YP_004142947
UniProt: E8T7P6
Position
3918131..3920410
Genome map
AA seq 759 aa AA seqDB search
MNQAAPAPRENQGDPVVRIDARLKVTGQAGYPADIVTANVAYGALATSSIARGKVSGLHT
KDARAVPGVLDIVTYDDMDKTDTPKFGNTGASSIGPLHDKTVFHDGQIIALVVAETFEAA
EEAAMLIRADYEDERPAASFDSKGVKMEPAAGKNPMFKEDAKAGDFDAAWADATVKIDEK
YSTPTQHHNPIELFSTTAIWQGDQLTIHEPSQNVTGWKVELARQLKLDPANVRIVSPYIG
GAFGSKGPMTARTAIVAVAARRIGRPVRCVVNRMQAFGTQTYRAETRHRIRMGAGKDGRI
TAFGHEAWEVTSRPDPYVVGGTSATARMYNYGAVLTHVSLVHADRNTPGYMRSPPETPYV
YALENAMDEMAVALGMDPVEFRRINEPEKEPIGGKPFSSRSLIKCYDQASEAFGWSKRDP
KVGSMRDGDWLVGMGCATAIYPTAAAPCAARVRLTADGEVRVQCGSHEIGTGVRTIAGQM
AAERLGIGMDKISVEMGDSALPPAPVSGGSISTASVCSAVMKACDAIRGKLFAAAAGRGA
PLAGSGNAKLDLKDEEVVTETGKSAKLADVFKAMQVGAIEEYAEFAPKGSSPEALSKLYA
GQSEFHGGENDEDSVKYAFGAEFVEVRINSYTREIRVPRIVGAFAAGRIMNTRTARSQLM
GGMIWGIGQALHEATEIDQRHARYVNRDLQDYLVPVNADIKQVDVILVPEIDHQVNPAGV
KGLGELGNVGTAAAVASAVYHATGKRIRDLPIRIDDLIG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctgcacccgcccccagggaaaaccagggcgatccggttgtccgcattgac
gcccggctaaaagttaccggacaggccggctatcccgccgacatcgtcacggccaacgtc
gcctacggtgcccttgccaccagcagcattgcccggggcaaggtttcgggacttcacacg
aaagacgcccgggccgtacccggtgtgctggacatcgtcacctatgacgatatggacaag
accgacacgccgaaattcggcaacaccggcgcaagttcgatcgggcctttgcacgacaag
acggtttttcacgacggtcagatcatcgctctggtggttgccgagaccttcgaggcggcg
gaggaagccgcaatgttgatccgcgccgactatgaggacgaacggcccgccgccagcttt
gattccaagggcgtgaagatggagccggctgccggcaaaaacccaatgttcaaggaggat
gcgaaggccggtgatttcgatgccgcctgggcggatgcgacggtaaagatcgacgaaaaa
tattcgacgccgacccagcatcacaatccgatcgaactgttttcgaccaccgcaatatgg
caaggcgaccagttgaccatacacgagcccagccagaacgttaccggctggaaggtggaa
ctggcacgccagctgaagctcgatccggccaatgtgcggatcgtcagtccctatatcggc
ggcgccttcggctccaaggggccgatgacggcacgcaccgctatcgttgccgtcgcggcg
cgacgcattggccgcccggttcgttgcgtcgtcaatcgcatgcaagccttcggtacgcag
acctatcgcgccgaaacgcggcataggatccgcatgggcgccggcaaggacggccgcatc
acggcgttcggacatgaggcctgggaggtgacgtcacgccctgacccttatgtcgtcggc
ggcacgtccgccaccgcgcgcatgtacaattacggcgccgttctgacgcatgtttcgctg
gttcacgccgaccgcaacacgcctggctacatgcgatcgccgccggagacgccttatgtc
tacgcgctggaaaacgccatggatgaaatggccgtggccctcggcatggatcctgtcgag
tttcgtcgcatcaatgaaccggagaaggagcccatcggaggcaagccattttccagccgc
tcactcatcaagtgctacgaccaggcgtcggaggcctttggctggtcgaagcgcgatccc
aaggtcggctcgatgcgcgacggcgactggctggtcgggatgggctgtgcgacggcgatc
tatccgactgccgccgcgccctgcgcggcccgggttcgtctcaccgccgacggcgaggtt
cgagtccagtgcggctcgcatgaaatcggcaccggcgttcgcaccatcgccggccagatg
gcggccgaaagactgggcatcggcatggacaagatcagcgtcgagatgggcgacagtgcc
ttgccgccggctcccgtgtcgggcggatcgatctcgaccgccagtgtctgctcggcggtc
atgaaagcctgcgacgcgatacgcggaaagctgttcgccgccgctgcgggcaggggggct
ccgctggccggttcgggcaatgcgaagctggacttgaaggacgaagaggtcgtcaccgag
accggcaaatccgcaaagctggctgatgtcttcaaggctatgcaagtcggcgccatcgag
gaatatgccgagtttgcgccgaagggttcttcgcctgaagccctcagcaaactctatgcc
ggacagtcggaatttcatgggggagagaacgacgaagattcggtcaaatatgcctttggc
gccgagttcgtcgaagtgcgcatcaacagctatacacgcgaaatccgggtcccgcgcatc
gtcggggccttcgccgccgggcgcatcatgaacacgcgcaccgcgcgcagccagctgatg
ggtggcatgatctggggtatcggccaggcgttgcacgaggcgacggaaatcgatcagcga
cacgcgcgctacgtcaaccgcgacctgcaggactatctcgtgccggtcaacgccgacatc
aaacaggtcgacgttatcctggtccccgaaatcgaccatcaggtcaaccctgccggcgtc
aagggtttgggcgaactcggcaatgtcggaacggctgctgccgtggcgagtgccgtctat
catgccaccggcaagcgcattcgcgatctgccgatcagaatagacgatttgataggctga

DBGET integrated database retrieval system