KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3782Help
Entry
Mesci_3782        CDS       T01401                                 

Definition
(RefSeq) HAD-superfamily hydrolase
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP DUF87 AAA_16 Hydrolase AAA_22 IstB_IS21 AAA_18 Hydrolase_6 ABC_tran AAA AAA_29 RsgA_GTPase AAA_24 APS_kinase NACHT TrwB_AAD_bind CbiA ArgK Hpr_kinase_C Sigma54_activat AAA_28 DUF815 AAA_30 AAA_5 RNA_helicase NTPase_1 PRK
Motif
Other DBs
NCBI-GeneID: 10119268
NCBI-ProteinID: YP_004142949
UniProt: E8T7P8
Position
complement(3920942..3922651)
Genome map
AA seq 569 aa AA seqDB search
MYFIALATDYDGTLAHDGVVAKKTLTALERFKKSGRKLVLVTGRELPDLKGVFPELSLFD
KVVAENGAMIYTPASEEERVIAPPPEPKFVARLKRQGVKPLSVGRSIVATWEPHQATVLE
VIKKMGLELEIIFNKGAVMILPSGINKATGLAAALQDLRLSPHNVVGVGDAENDHAFLQA
CGCSVAVDNAIPAVKDTANLVMRGARGKGVEQLIAKLIKRDHAIVPKRHDGIVLGSSGGD
DTYLSPSDTILIAGSSGIGKSTLATALTERFVESGFQFCVFDPEGDYDGLEGAVRLGDGS
SAPTKAQVLDLIAKADSNIVVNGLALRVDERPDFFADLLPGLSSFRRRTARPHWLVIDEA
HHLLPKRRDDTRAVLSLELPGTILITVHPEAISTDALRLVTAIIALGPKAKDVVKVFCRE
TGIEPPKVIPSPKGARVLFWRPQAGKKVKTVKVVEPRQSLKRHSRKYAEGQLDEAGSFYF
HGPENAMNLRAHNLMIFAQIAEGIDDKTWEFHLRTGDYSKWFRHQIRDKDLARETAQAEE
DKTLSAEESRKRVLDAVRRRYTAPATAPE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcattgcattggcgactgactatgacggcacgctggctcatgatggggtcgtc
gccaagaaaacgctcactgcgcttgagcggttcaagaaaagcggccgcaagctggttctc
gtcaccgggcgtgaactgcccgatctcaagggcgtctttcccgagcttagcctcttcgac
aaggtcgtcgctgagaatggcgcgatgatctacacgccggccagcgaggaagagcgggtg
atcgccccgccgcccgagcccaaattcgtcgccaggttgaagaggcagggcgtcaagccg
ctttcggtcggacgatcgatcgtcgcgacctgggaaccgcatcaagcgaccgtgcttgag
gtcatcaagaagatggggctcgaactggaaatcatcttcaacaagggcgcggtgatgatc
ctgccgagcggcatcaacaaagccaccgggctcgccgcggcccttcaggaccttcgactt
tcgccgcacaacgtcgtcggcgtcggcgacgccgagaacgatcatgcgttcctgcaagcc
tgtggctgcagcgtcgccgtcgacaatgcaattccggcggtcaaggatacagccaacctg
gtcatgcgtggcgcccgaggcaaaggcgtggagcaactgatcgcaaagctgataaagcgt
gatcacgcgatagtgccgaagcgccatgacggcatcgttcttggatcatctggcggcgac
gatacctacctgtcgccgagcgacacgatcctcattgccgggagttccggtatcggtaaa
tccaccttggccaccgcgctgaccgagcgcttcgtcgaaagcggctttcagttttgtgtc
ttcgatcccgaaggcgactatgatggcctcgaaggcgccgttcgcctgggagacggctca
agcgcgccgacaaaggcgcaagtgctggatctgatcgccaaggccgacagcaatatagtc
gtcaatggactggccctgcgggtcgacgagaggccggatttctttgccgacctgctgcct
ggcctcagcagtttccgccggcgcaccgcgagaccgcactggctcgtgatcgatgaagcg
catcatcttctgcccaagcggcgcgacgatacgcgggcggttctgtcattggaattgcct
ggcacaatcctgatcaccgttcaccccgaggcgatctcgacagacgccttgcgcctggtg
acagccatcattgcgcttggccccaaggcaaaggacgtcgtgaaggtcttctgccgtgaa
accggcattgagccgccgaaagtcatccccagcccgaaaggtgcgcgcgtgctgttctgg
cggccgcaggcaggcaaaaaagtcaagacggtcaaagtggtcgaaccacgtcagtcactc
aagcggcacagccggaaatatgccgaaggccagctcgacgaagccggcagcttctatttc
catggccctgagaatgcgatgaatctcagggctcacaatctgatgatcttcgctcagatc
gccgagggcatagatgacaagacctgggagtttcatttgcgcaccggcgactattccaaa
tggtttcgacatcagatcagggacaaggacctggcgcgcgaaaccgcccaggcggaagag
gacaagaccctgtcggcggaggagagccgcaagcgggtgcttgatgccgtgcgccgccgt
tacacggctcccgccacagccccggagtga

DBGET integrated database retrieval system