KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3784Help
Entry
Mesci_3784        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119270
NCBI-ProteinID: YP_004142951
UniProt: E8T7Q0
Position
complement(3923454..3923603)
Genome map
AA seq 49 aa AA seqDB search
MGRLLFMVAFACVAYRIYTETAGSARHVPQDDGEALRKQSAALGVDPSR
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtctgcttttcatggtggcgttcgcttgtgtagcgtatcgcatctacacggaa
accgcagggtctgctcggcatgtgccgcaggatgacggtgaggcgctgcgcaagcaatca
gcggcactgggcgtcgacccgtctcgctga

DBGET integrated database retrieval system