KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3786Help
Entry
Mesci_3786        CDS       T01401                                 

Definition
(RefSeq) TetR family transcriptional regulator
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_1 TetR_N
Motif
Other DBs
NCBI-GeneID: 10119272
NCBI-ProteinID: YP_004142953
UniProt: E8T7Q2
Position
complement(3924928..3925623)
Genome map
AA seq 231 aa AA seqDB search
MVAKRSGARSKGDQRISVSLQPVQQASTEPPLSRERIVATAVELLDAQGIDGLTMRRLAD
RLGSGVMSLYWHVDNKEDVFDLAVDSVLEHRGSPETGESPDWRGDVVHMLEDWRARMLRH
PWSASLLPRRALGRNILGRLEMLSKTLSRAGVADADLNAAIWSLWNYVMGATLTRASFDL
SEEDRAAAQQRLTHLSEHYPTIERSRLLLDNDWDGAFRRGLDFLLDGLSPR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtagccaaacgcagcggcgcccggagcaaaggggatcaacggataagcgtgtcgctc
cagcccgtgcagcaagcgagcaccgagccgccgctgtctcgagagcgtatcgtggcgacc
gcggtggaactgctggacgcccagggcatagacggattgacaatgcgtcggctggccgat
cgcctcggctcgggtgtgatgagtctatattggcacgtcgacaacaaggaggatgtcttt
gatctagcagtcgattcggtgctcgaacatcgcggatcgcctgaaacaggtgagtctccg
gactggcgcggagacgtcgttcatatgctcgaagactggcgcgccagaatgttgcgccat
ccttggtcggcatcgctgttgccgcgccgggcgctcggtcggaacattctcggtcgcctg
gaaatgctgagcaagaccttgtccagagccggtgttgcggacgcggatctgaacgccgcg
atatggtcgctctggaactatgtgatgggcgctaccctcacccgggcaagcttcgacctc
tcggaagaagacagggcagccgcacagcagcgtcttacacatctcagcgaacactacccg
acaatcgaacgctctcgtctgctgttggacaacgattgggatggcgccttccgaagaggc
ctcgacttcctgctcgacggcctctcgccaagatag

DBGET integrated database retrieval system