KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3787Help
Entry
Mesci_3787        CDS       T01401                                 

Definition
(RefSeq) endoribonuclease L-PSP
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP
Motif
Other DBs
NCBI-GeneID: 10119273
NCBI-ProteinID: YP_004142954
UniProt: E8T7Q3
Position
3925861..3926298
Genome map
AA seq 145 aa AA seqDB search
MTIAVPTASPANEFKLTIVNPQALYDPSPNGYSTAVIAPLGARIAYISGQGGQDSTGTLS
PDFAVQVKQAYANLHAALEGIGAKPDQVAKLTVFVVDHDMSKLEVLTRNVKDMFGEALPA
QTLVPVPKLAIDPMLFEVEATVILE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgcagtccccactgcgtcgccggcgaacgagttcaagctgactattgtcaat
ccacaggcactctacgacccgtcgccgaatggctacagcaccgccgtaatcgcaccgctc
ggagctcggatcgcctacatctccgggcagggcggccaagacagcacaggaaccttgtca
ccggatttcgccgtccaggtgaagcaggcctacgcaaatttgcatgctgcgcttgagggc
atcggcgccaagccggatcaggtggcgaagctcacggtcttcgtggtcgaccacgacatg
tccaagctcgaggtgttgaccaggaacgtcaaggacatgttcggcgaggcgctgccggcg
cagactctggttcccgttcccaagcttgcaatcgatcccatgcttttcgaggtggaggcc
accgttattctggaatag

DBGET integrated database retrieval system