KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3788Help
Entry
Mesci_3788        CDS       T01401                                 

Definition
(RefSeq) integrase catalytic subunit
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_28 HTH_29 HTH_23 HTH_32 rve rve_3 LZ_Tnp_IS481
Motif
Other DBs
NCBI-GeneID: 10119274
NCBI-ProteinID: YP_004142955
UniProt: E8T7Q4
Position
complement(3926687..3928084)
Genome map
AA seq 465 aa AA seqDB search
MSEGDGGLGLILMSERELQRIEVLSKVLEQRMTVVSAAHVLDMTTRQVQRLLKAFRVEGA
AALRHKARGRPSNHRYVAGIGELAVQLVREHYLDFGPTLAAEKLAANHGLVVSRETLRKW
MAEAGIWLSRKHRRTFHQPRLRRESYGELVQIDGSDHRWFEERGDPCTLLVFIDDATSAL
QQLRFVKSESTFSYFEALELYLKTHGCPVAFYSDKHTVFRVAKAEARAGRGMTQFGRALS
EFNIEILCANSSQAKGRVERVNRTLQDRLVKELRLAGISDIEAANAFLPAFMVDFNERFA
KVPARPDNLHRALNVAPDRLRDVLCKREQRYVGQQLSFSYERRQIMLEKNELSCGLVGKY
VDIHEFADGRLDVRWRACSLPYTVFDKEQRVTHTAVTENKRLGEVLTWIKAQQDEARPPP
KIKTNSEQSAYKKRGTKPGRRTDFMNDPAVIARREQALASLTAAE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagggagacggcgggttgggactgatcttaatgagcgagcgcgagctgcaacgc
atcgaggtgctgtcgaaggttttggagcagcgcatgacggtcgtctcggcggcgcatgtg
ctggatatgacgacccgccaggtccagcgtctgctgaaggcgttccgcgtcgaaggcgcc
gcagcacttcggcacaaggctcgaggacgaccgtcaaaccatcgatatgtcgccggcatc
ggcgaactggcggttcagttggttcgggaacactatctcgacttcgggccgaccttggcg
gccgagaagttggcggcgaaccacggcctggtcgtgtcacgagagacgttgcgcaaatgg
atggcggaagctggaatctggctgtcccgaaagcaccgcaggacgttccatcagcccaga
ttacgtcgggagtcgtatggcgagctggtgcagatcgacggcagcgatcaccgttggttt
gaggagcggggcgacccatgcaccctgctcgtcttcatcgacgacgcaaccagcgcgctt
caacaacttcgctttgtgaagtcggagagtacgttcagctacttcgaagcgctggagctt
tatctgaagacgcacggttgtccggtcgcattctattccgacaagcacacggtgtttcgg
gtggcgaaggccgaggctcgcgccggccgcggcatgacgcagttcgggcgtgccttgtct
gagttcaacatcgagatcctttgtgccaattccagccaggccaagggccgggtcgaacgg
gtcaatcggacgctgcaggaccggcttgtgaaggaactgcggcttgccgggatatcggac
atcgaggcggccaatgcgttcctgccggcgttcatggtcgacttcaacgagaggttcgcc
aaggtccctgcccgaccggacaatctgcatcgcgcattgaatgttgcgccagatcggctg
cgtgacgtgctgtgcaagcgggagcagcgttatgtcggccagcaattgtcgttctcctac
gaacgcaggcagatcatgcttgagaagaacgaactttcgtgcggactggtcggcaaatac
gtcgatatccatgagttcgccgacggtcggctggatgttcgatggagagcgtgttccttg
ccctacaccgtcttcgacaaggagcagcgcgtcacgcacacggcggtcaccgagaacaag
cggctcggcgaagtgctgacttggatcaaggctcagcaggatgaggcgcggcctccgccg
aagatcaagaccaacagcgagcagagtgcctacaagaagcgcggaaccaagccgggccgc
aggacggacttcatgaacgatcctgcagtcatcgcgcggcgagaacaggcactggcaagc
ttgaccgctgccgagtga

DBGET integrated database retrieval system