KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3801Help
Entry
Mesci_3801        CDS       T01401                                 

Definition
(RefSeq) helix-turn-helix domain-containing protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_25 HTH_37 MqsA_antitoxin AbiEi_3
Motif
Other DBs
NCBI-GeneID: 10119287
NCBI-ProteinID: YP_004142968
UniProt: E8T7R7
Position
3940091..3940318
Genome map
AA seq 75 aa AA seqDB search
MTPAQCRAARALLNWSQQDAADAAKIGNATIRNFEAGRSTPQNATLEVLQRAFEAAGVEL
IPENGGGAGVRMQKP
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgctcaatgccgcgctgcccgcgcccttctcaactggtcccagcaggatgcg
gccgacgcggcgaagattggcaacgcaacaatccgcaacttcgaagccggccgatcgaca
ccgcaaaatgccacgcttgaagtacttcagcgcgcatttgaggcggcgggagtggagtta
atcccagagaatggcggcggagcgggggtaaggatgcagaagccgtga

DBGET integrated database retrieval system