KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3803Help
Entry
Mesci_3803        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119289
NCBI-ProteinID: YP_004142970
UniProt: E8T7R9
Position
complement(3941906..3942148)
Genome map
AA seq 80 aa AA seqDB search
MARSKPSKQLSQAEIDRFLVAAEALHLSIVKPFISPYCDHYRQTRVLHEVLLKAVRDVTG
KEVEFIQWHTTGPVRSPTAG
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggctaggtcaaaaccgtcaaagcaattatcacaggctgaaatagatcgctttctggtg
gcagcggaagcgctgcacctgagcatcgtcaagccattcatatcgccgtactgcgaccac
taccggcagacgcgcgtcctgcatgaggtgctcttaaaggcggtgcgggacgtcaccggg
aaagaagtcgagttcatccagtggcacaccactgggccggttcgatcgcctacggctgga
tag

DBGET integrated database retrieval system