KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3812Help
Entry
Mesci_3812        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S74
Motif
Other DBs
NCBI-GeneID: 10119298
NCBI-ProteinID: YP_004142979
UniProt: E8T7S8
Position
complement(3950222..3951214)
Genome map
AA seq 330 aa AA seqDB search
MCAPDAPAPPDPKETSAASTATNVGTAIANANLGNVNQVTPDGSLNYSQTGTYKWNDPYT
GKSYDIPTYTATQTLSGTGQAIKDQTDQAKLNLGELAAGQSSFLKDWLAKPVDLSNDATE
GRLMDLGMKRLQPALDARRQANEADLINRGIRPGSDNYAQAQNIQDQGENDAYNSLLLSG
RGQAVQEALAQNSAPINNLTALLSGSQVSQPNFVNANMPTIPTTDTAGLINTNYNQQLQK
WQQDASSSSDLMGGLFGLGANLIKFSDRRLKKNIRAIGTFANGLTKYVFEYLWGGGEQVG
VMADEVRAYRPYAVTTVNGFDAVDYGRAFA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgccccagacgctcccgcaccgcccgatccgaaagagacttcagcagcgtcgacc
gcaacgaacgtcggcaccgcgattgcgaatgctaacctcggcaacgtcaatcaggtgacg
cccgatggctcgctgaactattcgcagacgggaacctacaagtggaatgatccctacacg
ggaaagtcctatgacatcccgacctacacggccacgcaaacgttgtcgggaaccggtcag
gcgatcaaggaccagaccgaccaggcaaagctgaacctgggcgaactggccgccggccaa
tcgtcgtttctgaaggattggctcgccaagccggtcgacctgtccaacgacgcaacggaa
ggccggttgatggatctcggcatgaagcgccttcagccggcgctcgatgctcgccggcag
gcgaacgaagcggacttgatcaatcgcggcattcgtccaggttcggataactacgcccaa
gcgcagaacatccaggaccagggcgaaaacgacgcctacaattcgttgctgctgtccggt
cgcgggcaggcggtgcaggaggccttggcccagaattcggccccgatcaacaacctgacg
gcgctgctctcgggttcacaggtcagccagccgaacttcgtcaacgcgaacatgccgacc
attccgacaacggacacggcaggcctgatcaacaccaactacaatcagcagcttcagaag
tggcagcaggacgccagcagcagcagcgatttgatgggcggcctgttcggtctgggcgcg
aacctgatcaagttttcggaccgccggctgaagaagaacatccgcgcaatcggcaccttt
gcgaacggcctgacgaagtacgtgttcgaatatctctggggcggcggtgaacaggtcggc
gtcatggctgacgaggttcgcgcctatcggccttatgcggtgacgacggtcaacgggttc
gatgccgtcgactacgggagggcattcgcatga

DBGET integrated database retrieval system