KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3818Help
Entry
Mesci_3818        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-l_SbsC_C
Motif
Other DBs
NCBI-GeneID: 10119304
NCBI-ProteinID: YP_004142985
UniProt: E8T7T4
Position
complement(3955204..3955695)
Genome map
AA seq 163 aa AA seqDB search
MTSFVGANITKTYTAADLTGAESGKAPRLGDTYESYDGKVYRFVKYNSGAGAIAAVANNV
VGFYAPGGVSAGQSNEVTSDVSDTAANGAGVLAAAPGNGEYGWIQVKGVATLTTALVSGA
DGNALVLSATTDGTLKVAAAVTDTVCAYAIDASAKIVMCAFPY
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttttgttggcgccaacatcaccaagacctacaccgcggccgatctcacgggc
gcggaaagcggcaaggcaccccgccttggcgacacctacgaatcgtatgacggcaaggtc
tatcgcttcgtgaaatacaactccggtgccggcgcaatcgccgccgtcgccaacaacgtg
gtcggcttctacgcaccgggcggcgtctctgccgggcagtcgaacgaagtgacctcggat
gtatccgacaccgccgcaaacggtgccggcgttctcgctgctgctcccggcaacggcgaa
tacggctggatacaggtcaagggtgtggcaacgctcacgaccgcgctggtttccggcgcg
gacggcaacgcccttgtcttgtcggccaccacggatggcaccctgaaggttgccgccgcc
gtgactgatacggtctgcgcctacgcaatcgacgcttcggcgaagattgtcatgtgcgcc
ttcccatactga

DBGET integrated database retrieval system