KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3821Help
Entry
Mesci_3821        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119307
NCBI-ProteinID: YP_004142988
UniProt: E8T7T7
Position
complement(3957797..3958087)
Genome map
AA seq 96 aa AA seqDB search
MARYVFRNGIFVDRQTGAPMEKPFAGQISMPNVISDIPEYRSPINGAVIGSRSQRRDDLK
KHNCVEYEPSLSPTNGKFRNPDFCQKRGLQVSEEFR
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggctcggtacgtgtttcgaaacggcatctttgtcgaccggcaaacgggcgctcccatg
gagaagccattcgccggccagatcagtatgccgaatgttatctccgatattccggagtac
cgctcgccgatcaacggcgcggtaatcggctcacgctctcagcggcgcgacgatctgaag
aaacacaattgcgtcgagtacgagcccagcctttccccgaccaatggcaaatttcgcaat
cccgacttctgccagaagcggggccttcaggtgtcagaggaatttcgatga

DBGET integrated database retrieval system