KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3823Help
Entry
Mesci_3823        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119309
NCBI-ProteinID: YP_004142990
UniProt: E8T7T9
Position
complement(3958526..3959806)
Genome map
AA seq 426 aa AA seqDB search
MRIPSGKVDQYIYFVAVDSVDLKTKKTGLTGFTVLRERNGLNRAFYTTPTIVELDSVNCP
GLYRLLIDEDTTIAAASDAEEYVVHINVAGMAPVIRVIELFRRDTTSGRTQLVDANGRVD
VSAIAGTAQTARDIGASVLLSSGTGTGQISLTAGVAASNVTQFGGAAGAFAAGRPEVNMT
HIAGSAVSATTAQLGVNVVNAGGTAWNSGAITANTFAAGALTAAKFAANALDAVWSTTTR
ILTAGTNIVLAKGTGVTGFNDLDAPGVRTAVGMASANLDTQLAAIGNKTINLPPDPADAS
DIATATTAIFNRLGAPAGASFSADIAAVKADTGAIKVKTDNIPATPAAVGDIPSATTVAT
AVHDTVVDGALTFRQSTRLQNASLLGKASGMTTATAVFRDVSDTRNRIVASVDADGNRLG
VTLDPN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagaattccatccggcaaagtcgaccaatacatctacttcgtcgcggtcgacagcgtt
gacctgaagacgaagaagactggcctcacggggttcaccgttctgcgcgagcgcaacggc
ctcaatcgtgcgttctacaccaccccgaccatcgtggaattggatagcgtcaactgtccc
ggtctttaccgcctcctgattgatgaagataccaccatcgctgctgcctccgacgcagag
gaatacgtcgtccacatcaacgttgcgggcatggctccggtgatccgggttattgagctg
ttccgccgcgacacgacgagcggccgaacccagcttgtggacgccaacggcagggttgac
gtttctgcaatcgcaggcacagcgcagaccgcacgcgacatcggcgcaagcgtgttgctt
tcctctggcaccggtaccggacagatcagcctgactgccggtgtggcggcctcgaatgtc
acccagttcggcggcgctgccggcgcatttgccgctggtcggccggaggtgaacatgacg
catatcgcgggctctgccgtgagcgcgaccaccgcgcaactcggcgtcaacgtggtgaac
gctggcggcacggcatggaactccggcgcgatcaccgccaacaccttcgcggccggcgcg
cttactgccgccaagtttgcggccaacgcgctcgatgccgtttggtcgaccaccacgcgc
atcttgaccgccggcacgaacattgtcctggccaagggaacaggggtgacaggcttcaac
gacctggatgcgccgggcgtgcgcaccgctgtcggtatggcctcggccaatcttgacacc
cagctagccgcgatcggcaacaagaccatcaatctgccgcccgatcccgccgacgcatcg
gatatcgccacggcgactactgccatctttaaccgccttggcgccccggcaggagcttca
ttctcggccgacatcgctgcggtcaaggctgataccggagcgatcaaggtcaagaccgac
aacatcccggccactcccgctgctgtcggcgacatcccgagcgccacgactgtcgcaaca
gccgttcatgatactgtggtggatggagctttgaccttccgccagtcgaccaggctgcag
aatgcttcgctgctcggcaaggccagcggaatgacgaccgcgaccgctgtcttccgcgat
gtttcagacaccaggaaccgaattgtggcctcggtcgatgctgacggaaaccgcctgggc
gtgacgctggacccgaactga

DBGET integrated database retrieval system