KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3851Help
Entry
Mesci_3851        CDS       T01401                                 

Definition
(RefSeq) acyltransferase
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DUF1624
Motif
Other DBs
NCBI-GeneID: 10119338
NCBI-ProteinID: YP_004143018
UniProt: E8T7W7
Position
complement(3980968..3982071)
Genome map
AA seq 367 aa AA seqDB search
MGKGTSRLDGLDALRGMAAIAVAIYHTLILMKLVPVPELPWIVTTFYIAVPLFYAVSAFS
MCAGYVDRLENGAQIGAFYARRFLRIAPLFYVMIGAWILFYSYLWGSWHLPPLGDIALNF
AFIFNFFPSASSSVVAAGWSLGNEAIFYALFPALIIILTNVWRCVWALLFSLAVAVFAGI
MLTSVPNQFGWFTILVQAPFFIVGILMFHIFTRLKDKTATERKWLALALIALSGVSLYLL
SQVPGSWMIFDGWSASPHLIGLAFSPLVLSFALFKFFVLVNRLTVYIGTISYGIYLIHPL
VIASINSSPLKSMLPELSVLVVILSVLIPVVALASVSYRWFELPFMRLTSRPKKSVLTPQ
PAALPAE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggggacttctaggcttgacggactggacgcgttgcgcggcatggccgcaatc
gcagtggcgatctaccatacgcttattctgatgaagctggtcccggttccagagttgcca
tggattgtcacgacattctacatcgccgtgccgctcttctatgctgtttcggctttctcg
atgtgcgctggctatgtcgatagattggaaaacggcgcgcagatcggggccttctacgct
agacgcttcctacgcatagcgccgctcttctatgtgatgatcggtgcttggatactgttc
tattcgtatctgtggggctcttggcatctcccgccacttggcgatatcgctctcaatttc
gctttcatcttcaattttttcccatcggcctccagcagtgttgtcgctgcgggatggtct
ctcggcaacgaggccattttctacgctctgtttccggcgctgattatcatcctgacaaat
gtctggcgctgcgtttgggctctacttttctctctggctgtcgcagtgtttgccggcatc
atgctgacgtcggtccccaaccagttcggctggttcacaattttggtccaggctccgttc
ttcatagttggcatcttgatgttccacatcttcacgagactgaaggacaagactgcaacg
gagaggaagtggctggccttggcccttatcgctctgtccggcgtcagcctctatttgctg
tctcaagtgcccggatcatggatgatattcgacggatggtccgcctcgcctcacctgatc
ggtctggccttctcgcctcttgtgttgtcgttcgccctgttcaagtttttcgttcttgtg
aaccgcttgacggtctacattgggacgatcagctacggcatttatttgatccatccgctt
gtgatcgcttcaatcaatagctcgccgctgaagtcgatgctgccggagttgtcggtattg
gtggtgatattgtcggtactgatccccgtcgtcgctctggcgtctgtctcctatcggtgg
tttgaactcccgttcatgaggctgacgagcaggcccaagaaatcggttctgacgccacag
ccagccgcattacccgccgaataa

DBGET integrated database retrieval system