KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3853Help
Entry
Mesci_3853        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119340
NCBI-ProteinID: YP_004143020
UniProt: E8T8S2
Position
complement(3982846..3983331)
Genome map
AA seq 161 aa AA seqDB search
MQVTRTFSHREFGHLGEATLAVEKGKWTLDGQALPDPSVEYLMGFALQSLQDAYAGAKSQ
EAASAAFDAKRKRLIEGAIGRTAGPAEEPHVRFIRQMVRNALSPDNKARYEQTEAKDRNK
FLMVLFTGLPTSKRERLDAQARTAHEASLAAKAATEFELTI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcacgcgcacgttttcacaccgcgagtttggccacttgggcgaggcaactttg
gccgttgaaaaaggcaaatggacactcgacggccaagcccttcccgacccctcggttgaa
tacctcatgggcttcgccctccaatccctgcaggacgcatacgcgggtgccaagagtcag
gaggcggccagcgccgctttcgacgccaagcgcaaacggttgatcgagggagccattggg
cgaacggctggcccggccgaagagccgcacgttcggtttatccggcagatggttcgcaat
gcgctcagccccgacaacaaggcccgatatgagcagaccgaggcgaaagaccggaacaaa
ttcctcatggtgcttttcacggggctacccacctcgaaacgcgagcgtctcgacgcccaa
gcgcggactgcccatgaggcatcactcgccgcgaaggccgcgaccgagtttgaactaacc
atctaa

DBGET integrated database retrieval system