KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3854Help
Entry
Mesci_3854        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119341
NCBI-ProteinID: YP_004143021
UniProt: E8T8S3
Position
3983912..3984229
Genome map
AA seq 105 aa AA seqDB search
MVAENKALILWNVDDEPMVIHDLIVVNIDEQDARTENYLASGGACDEDWLDSKLQTPMGL
FLYLSTYYGFKDRKVLRKAIYEFSKIDGDDWSKDLMSTMFDPTED
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtagctgagaacaaagctctaatcctctggaacgtcgatgatgagccgatggtcatt
catgaccttattgtcgtaaacattgacgaacaagacgcgcgcactgaaaactatctcgcg
agcggtggggcctgcgatgaagattggttggactccaaactccagactcccatgggcctc
tttctgtacctctcgacctactacggtttcaaggatcgaaaagtcctgcggaaagcaata
tacgaattcagtaagatcgacggagacgattggtccaaagacctaatgtcgacgatgttc
gatccgacagaagactaa

DBGET integrated database retrieval system